CAZyme Information: MGYG000002299_01197

Basic Information

• Species: Vagococcus sp003462485
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Vagococcaceae; Vagococcus; Vagococcus sp003462485
• CAZyme ID: MGYG000002299_01197
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	MGYG000002299_3|CGC1	83285.45	5.9394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002299	2039592	Isolate	China	Asia

• Gene Location: Start: 11419; End: 13605 Strand: +

Full Sequence      

MLLSNIDTRHGTANQHSYSNGNTLPYTGVPFAMNYFCPQTTHQNGSWWFHPRDHTFQGIR
LTHQPSPWMGDFSHLLLSPVSGAINSTDLFFNQGSYRPEEATFQPHYLSIYSERHRILTE
LTAHTYGAHIRFTFNRKDMTAGMLFTAPGIKSLTIKNNHLTGYISNIAGCEDKKLKMYID
LSFSTNIESLKYHEHNHMIDLGTHYKGEEETLYLSFDKLASDGVLDVQLATSFISQEQAT
LNLERELPHTFEEHKNLAADKWLNYLNRIEVSDKSKDKILLFYQMMYRCFLFPQTWYELD
KDNQPIHYDTLSKTIKSGYYYTNNGFWDTCRSLFPLYSLIATEEYEKMLAGFYNAYKNSG
YLPKWLSPDERGLMPGTLIDAVIADAAVKHIATDKMPDFLEAMLKSATTVSGKDNYGRSG
TLDYLTYGYVPNHYHESVNHTQDYAYSDFCISQVAELLDDKDLAKKYAKQSLNYRNLIDF
DYGILRSKDKDGQPRTPFNPYAWGRDYAEGSAYQNSFAAFHDFSGLIQSLGGKERFKEII
TDLCNSYPIFDVDGYGFEIHEMSEMAAIDFGQIAISNQPSFHLPFLFNYIGELSTTQHIV
KELLSKAFKLGFDGYPGDEDNGSMSAWFVLNSLGFYPVTPGSGEYVLGIPFVDKAVIHLS
NGNDLTIQTNNNVPQYHYSKNILKNNQPYNHLFFTHNDLMTGGNIEFDLCLVPPIKHYTE
TDLPFSLT

Enzyme Prediction     

EC	3.2.1.113

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	211	709	1.7e-151	0.9837067209775967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3537	COG3537	0.0	2	728	38	759	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
pfam07971	Glyco_hydro_92	4.02e-169	238	709	1	463	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
TIGR01180	aman2_put	2.59e-83	22	709	47	744	alpha-1,2-mannosidase, putative. The identification of members of this family as putative alpha-1,2-mannosidases is based on an unpublished characterization of the aman2 gene in Bacillus sp. M-90 by Maruyama,Y., Nakajima,M. and Nakajima,T. (Genbank accession BAA76709, pid g4587313). Most members of this family appear to have signal sequences. Members from the dental pathogen Porphyromonas gingivalis have been described as immunoreactive with periodontitis patient serum. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
NF035929	lectin_1	9.02e-48	11	709	16	680	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
pfam17678	Glyco_hydro_92N	4.10e-26	6	232	2	231	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIL48950.1	0.0	2	728	1	728
QNN72215.1	0.0	2	728	1	728
QJX63905.1	3.57e-301	2	728	1	730
AYV73626.1	5.07e-301	2	728	1	730
QKH63098.1	7.77e-298	2	728	1	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE1_A	1.56e-272	1	728	1	710	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
6DWO_A	3.14e-272	1	728	1	710	Crystalstructure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_B Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_C Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_D Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
7FE2_A	4.45e-272	1	728	1	710	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
5SWI_A	6.53e-203	2	713	27	715	Crystalstructure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_B Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_C Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae],5SWI_D Crystal structure of SpGH92 in complex with mannose [Streptococcus pneumoniae]
2WZS_A	1.51e-135	11	728	12	734	Structureof the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86365	1.60e-48	22	713	62	753	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1
D4ATR3	3.68e-25	213	727	263	758	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.974707	0.024768	0.000302	0.000082	0.000042	0.000111

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002299_01197.