CAZyme Information: MGYG000002300_00188

Basic Information

• Species: Bacteroides cutis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cutis
• CAZyme ID: MGYG000002300_00188
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000002300_1|CGC3	44497.98	5.8475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002300	3878569	Isolate	China	Asia

• Gene Location: Start: 236570; End: 237733 Strand: -

Full Sequence      

MEKIKTTFIGVGYRGMQLLKLLRHIPFFEIVAVADPEISDVGIPDIVCYNNGNDDYLNML
DVHKPDLVFVTSPWQYHVKHAMQSVDRGCHVALEIKGGLYLNEYQPLIDLAEQRGCRIYP
LENTLFLREVMAVHEMVINGIFGEIVYMRGGYRHDLRSLLLDDVGNIGNREKTESIWRGK
FYQCDNGDIYPTHGLAPLCMIAGINRTDRIKFLTSFASKSVGMLQRIRELGGDEKVRITM
GDIVSTQLETEKGVLVLLTHDTTLPRPRSLDFEVQGTKGIWQGDHRQIYIEGNSPEEVWE
DDISYIDYYEHRYWRQWGKEALLRDTHHQGMDYIMLKALEEGIKGMSSYPATLHDLALWT
SITPWSKVSIAEHRTICCFGSLYEFNL

Enzyme Prediction     

No EC number prediction in MGYG000002300_00188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	375	9.3e-108	0.9548872180451128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.66e-17	1	372	1	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.13e-12	4	118	1	116	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT33801.1	1.85e-205	1	376	1	376
QQA30653.1	1.85e-205	1	376	1	376
QUT62197.1	1.85e-205	1	376	1	376
ADV42950.1	6.26e-203	4	376	10	382
QRO24037.1	2.17e-159	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.51e-84	2	376	19	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.64e-43	1	372	40	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	8.29e-84	2	376	19	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	8.78e-76	2	372	32	426	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	1.04e-69	3	385	49	449	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	2.16e-69	4	379	53	451	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4FN60	1.01e-58	2	373	59	432	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002300_00188.