CAZyme Information: MGYG000002300_00757

Basic Information

• Species: Bacteroides cutis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cutis
• CAZyme ID: MGYG000002300_00757
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002300_1|CGC17	41978.46	5.0349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002300	3878569	Isolate	China	Asia

• Gene Location: Start: 964530; End: 965657 Strand: +

Full Sequence      

MKKLVFVTVAFAMGCLLITSCSTSAKKQSTMDENSEFVRTPETGALLTNLKKVSSRGIMF
GHHDDTVYGIGWEGDEGRSDVKSVCGDYPAVISFDLGELELGGEANLDKVPFDKLRKEII
NQYRRGGMISLSWHVRNPLTGGDAWDVKDTTVVQSILPGGVNHEKFAGWLDKVAGFINSL
QTAEGVKVPVLFRPWHENSGSWFWWGEKLCTPEDYKALWRMTVDSLQSKGVDNALYAYSP
GTEPQDTTQYLERYPGDDLIDVIGFDTYQFDRDAFLAGLERSLAIVDSIGKSHDKVIAVT
EVGYEGIPDPKWWTGTLFPALEKYPVAYVLVWRNARERITHFYAPYPGQTSAGDFVEFYK
NPKTLFAADVNSLYK

Enzyme Prediction     

EC	3.2.1.-	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	40	333	1.2e-62	0.8844884488448845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.70e-36	40	268	6	230	Glycosyl hydrolase family 26.
COG4124	ManB2	2.22e-20	188	362	180	342	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT65049.1	9.98e-225	1	371	25	392
QUT33719.1	3.37e-224	1	371	1	368
QUU00579.1	3.37e-224	1	371	1	368
QQA30566.1	3.37e-224	1	371	1	368
QUT62100.1	3.37e-224	1	371	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.66e-171	39	375	8	344	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	4.57e-86	19	375	18	396	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	8.96e-86	19	375	41	419	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX5_A	9.12e-86	19	374	18	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX7_A	3.63e-85	19	375	18	396	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	5.34e-56	10	375	15	416	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	3.09e-43	35	374	43	402	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49425	6.73e-19	81	314	189	424	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P16699	2.65e-18	2	334	5	330	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
P55278	3.11e-17	47	332	45	322	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002300_00757.