CAZyme Information: MGYG000002300_00892

Basic Information

• Species: Bacteroides cutis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cutis
• CAZyme ID: MGYG000002300_00892
• CAZy Family: PL29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	MGYG000002300_2|CGC3	77970.23	6.3114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002300	3878569	Isolate	China	Asia

• Gene Location: Start: 135586; End: 137724 Strand: +

Full Sequence      

MKHSTLFGEGKVLFFLFLVLLFGGSLQACSDDETPLTLEISDEELVFGSDASSKKIEIKS
SAVWEAKVVSGADWCSYKDETNGVVSITVKANDSGAKRESKILFTCGTLKKVLLVIQENI
EPMLEITETELSFDVASGSKEIQVQSNIQWKAGVMTAGASWVTCVVKKEKPNILVIAVES
NSAMHQRKAIVSVTAGSLKKEISVIQAPYVPSVLYSRIEPNFDFSLLEDDFGNTLPDFSN
IGYKGGEVEIPEAPVVKVLSAPMQGVDATSMIQNAIDEVSRMPLTDNIRGAILLQKGQYE
VFGSLAIKASGVVLRGEGDGEDGTILVAAGKKAGYDAHHRLIKIAGSGKLTPSAPSSNNI
KEAYVPVGRFWVTVNNPGSFQVGDDVTIYRPGTNEWIHDLKMDQIEGGSGVKQWEASGYN
FAYERVVTKIIDDTLHFDNPIMMAMETRYGGGAVYKSTFSGRINHCGVENMQIISEYDKT
KKDKTGYYNDEDHSCTAIDMTKTEHSWIRNVTSKYFAYGLAELRDNSRYITVKDCKCFDG
VAVRTGGRLYSFLMDDVSSCLVIDCETTEGRHDCVTGSKGVGPNAFVRVKIRNSHADAGP
HHRWNIGTLYDNIDSDGQINVQDRADMGSGHGWAGANQFLWNCKGGRITVQNPWVSAKNF
SIGTKGNKHEGARKGRPDGVWIMQGKDVTPVSLYDAQLALRKQDGRLYHTGK

Enzyme Prediction     

No EC number prediction in MGYG000002300_00892.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL29	262	536	8.7e-19	0.8870431893687708

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14948	BACON	1.74e-16	37	118	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
cd14948	BACON	8.32e-14	124	207	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	6.88e-06	64	118	1	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.
pfam19190	BACON_2	0.002	124	207	2	89	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam19190	BACON_2	0.009	38	118	2	89	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT62233.1	2.18e-124	217	698	427	894
QMV68341.1	3.06e-124	217	698	427	894
QQT45112.1	4.29e-124	217	698	427	894
QRY56719.1	5.10e-123	229	698	415	870
QQT32413.1	3.47e-122	217	698	427	894

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000479	0.096848	0.902534	0.000042	0.000053	0.000045

TMHMM  Annotations     

start	end
12	29