CAZyme Information: MGYG000002300_01101

Basic Information

• Species: Bacteroides cutis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cutis
• CAZyme ID: MGYG000002300_01101
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	MGYG000002300_2|CGC8	47340.05	5.9002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002300	3878569	Isolate	China	Asia

• Gene Location: Start: 410833; End: 412071 Strand: +

Full Sequence      

MRIRLMSIVCLGAFLFSCKGNKQEADFVVNGFARAEQQLSAQLSELPEPTGYPRTIDRNG
NLRVTHKNDWTEGFYPGCLWYMYEYEDDKKWKDAAVKWTEALESLKTQTNHHDIGFLMYC
SFGNGYRLTGNEAYKEILLESARSLCTRFNEKIGCIESWNYRKAWNGKDEWFYPVIIDNM
MNLELLYFASKVTGDSIYARIANKHAETTALNHFRKDYSTYHVVNYDETTGRVLHQATCQ
GFSDNSTWARGQAWAIYGYTMAYRETQRHDFLNMAIHAADFWLNHPNLPEDGVPYWDFNA
GQDGYVPDWNYDPQAFKIIPRDASAAAIAASAFLELADYVDGGGKYEQAAEHILKSLSSP
AYLAEPGTNCNFVLMHSVGSIPHSSEIDVPLVYADYYYLEALLRYNNRKNKR

Enzyme Prediction     

No EC number prediction in MGYG000002300_01101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	65	405	1.9e-129	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.82e-14	62	273	21	220	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58165.1	3.04e-250	1	409	1	406
QUT90817.1	1.24e-249	1	409	1	406
QDO70891.1	8.00e-248	3	407	1	405
QIU93978.1	2.36e-245	3	409	9	408
QIU93748.1	1.00e-237	5	406	7	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.50e-115	53	405	56	388	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	3.70e-57	28	405	28	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.79e-57	28	405	29	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	5.32e-57	28	405	29	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	2.06e-56	28	405	29	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	2.36e-108	19	407	25	396	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	2.08e-56	28	405	29	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	1.70e-53	37	405	36	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	3.31e-51	52	404	24	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	2.14e-50	52	405	52	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002300_01101.