CAZyme Information: MGYG000002300_01776

Basic Information

• Species: Bacteroides cutis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cutis
• CAZyme ID: MGYG000002300_01776
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000002300_4|CGC1	81234.98	8.5737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002300	3878569	Isolate	China	Asia

• Gene Location: Start: 70126; End: 72291 Strand: -

Full Sequence      

MSDVILLPKNYNCMFIEKSLARLLGCIIFLLCAQSIIGKNDSDIEKIRKRCIERIISTNV
NGNIVDNLLQTLRADGTWPGIDYVDVSRTGFQHARHLANMVNLAIAYKKPGSLFRGKRSL
KQAFDKSMAYWLEHDFICDNWWNNQIDTPARMVTILLLMDKDLSKEQSDKMLQIISRGNI
NATGARPSGDRIKIAGIQAKAALYKRNVEEVEMLLKVIESEIKFSTKIGIQYDYSFHHRA
DRVNNTLTYGVGYGNAFVEWATLVNGTRFGFSQDSIRLIVDYYLDGICKQMIYGMISDPG
IGNRDITRPGKAVVWSADVVKNILTLTDYRKAELETVVRAREGENVIPQSYAKFFWCTDH
FVYQRPNFYTSVRMYSERNANMEEPYNGEGIMNHFRGDGTNYLSLEGDEYKNVIPVYDWM
KIPGTTTVQLDTMPLKENVQKWGLTKFVGAVSDDMYGAVGFEFKSPHTALTAKKSYFFFD
KEYVCLGSGITSRVKGRPVSTTINQCVLSGEVHVKDGRGAHVQSRGAVNIPKVEWVNHDN
VGYVFPEKSAVFLLNQEKTGSWTIANKQTSVSAEEVKCDVFTLALNHGKECKNASYEYIV
VPSVNHYEMEDYVHVLPVSVLTNTSELQAVRHNGLRIAYAVFYKHGTVHITGNLSVTIDS
PGLVMLKYNAAGNVTQLLVSDPTRLLKTIHLSINSGSGVLQRYAIDLPQNEYAGRSVKVK
L

Enzyme Prediction     

No EC number prediction in MGYG000002300_01776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	353	604	7e-75	0.9919678714859438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	5.99e-108	43	682	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	2.60e-91	353	605	2	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.17e-16	39	340	13	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	2.79e-15	621	689	1	66	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50612.1	1.01e-296	34	717	363	1061
AKP52686.1	6.78e-217	42	717	39	728
AEL27150.1	1.99e-216	29	717	27	729
QGY42588.1	5.02e-216	41	721	24	740
SCD21938.1	4.90e-214	28	720	11	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HM2_A	4.79e-88	26	720	8	700	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1CB8_A	2.15e-87	64	720	27	678	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
6F2P_A	1.87e-32	66	720	46	748	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
2E22_A	9.70e-24	103	684	78	699	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
1X1H_A	1.28e-23	103	684	78	699	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	2.62e-87	26	720	8	700	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	6.74e-23	103	684	103	724	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	2.65e-20	140	667	182	754	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q8A2I1	6.94e-14	338	682	607	931	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=chonabc PE=1 SV=1
C5G6D7	2.74e-13	338	682	607	931	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron OX=818 GN=chonabc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.280304	0.711830	0.006920	0.000314	0.000267	0.000359

TMHMM  Annotations     

start	end
20	37