CAZyme Information: MGYG000002301_01705

Basic Information

• Species: Staphylococcus warneri
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus warneri
• CAZyme ID: MGYG000002301_01705
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000002301_3|CGC3	35166.06	10.1009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002301	2673052	Isolate	China	Asia

• Gene Location: Start: 148641; End: 149639 Strand: +

Full Sequence      

MNKKIIAAIVGTSAVSAIAATQADAATTHTVKSGESLWSISSKYGISISKLKSLNNLSSN
IIFPNQVLKVSGSTSTSKPTSSSSTGTSSSTYTVKAGDSVSSIAAKYGMSYQKLMKLNGL
NSFLIHPGQKLKVSGTVSTSKPSSSASTTGSSSTYTVQAGDSLSSIAAKYGTTYQKIMSL
NGLSNFFIYPGQKLKVSGTASTSNSSSNTANSSNNGYNTPVFNHQNLYTWGQCTYHVFNR
RAQIGKGISTYWWNANNWDNAAAADGYTIDGKPTVGSIAQSDSGYYGHVAFVERVNSDGS
ILVSEMNWAASPGIVTYRTIPSYQVNTYRYIH

Enzyme Prediction     

No EC number prediction in MGYG000002301_01705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	155	196	3.5e-17	0.95
CBM50	92	133	1.9e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	4.71e-34	217	332	57	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	3.31e-22	31	196	335	523	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	2.69e-21	31	196	410	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	2.21e-19	228	321	508	606	amidase domain-containing protein.
pfam01476	LysM	1.56e-13	157	196	3	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXZ24361.1	4.67e-215	1	332	1	332
QNQ43723.1	4.67e-215	1	332	1	332
QDW97341.1	4.67e-215	1	332	1	332
VED76820.1	4.67e-215	1	332	1	332
VED33594.1	4.67e-215	1	332	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	1.10e-31	226	332	50	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	2.79e-29	226	332	9	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	4.45e-16	228	331	248	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	1.33e-08	154	196	4	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	7.68e-07	154	196	4	46	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2YVT4	2.89e-169	1	332	1	335	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sle1 PE=3 SV=1
P0C1U7	1.61e-168	1	332	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1
Q6GC24	1.61e-168	1	332	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1
Q2G0U9	1.61e-168	1	332	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sle1 PE=1 SV=1
Q5HIL2	1.61e-168	1	332	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.999032	0.000163	0.000201	0.000182	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002301_01705.