CAZyme Information: MGYG000002304_01575

Basic Information

• Species: UBA7182 sp003481535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7182; UBA7182 sp003481535
• CAZyme ID: MGYG000002304_01575
• CAZy Family: GT4
• CAZyme Description: N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000002304_3|CGC5	41005.89	8.3641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002304	3566085	Isolate	China	Asia

• Gene Location: Start: 253724; End: 254797 Strand: -

Full Sequence      

MAEKKKILYIVEAMGGGVFTYIVDLANELVKEYDMYIAYAVRKQTPENYMEYFDKGIHLI
EVKNFGRAINLVKDFMAFCEVQKIAREVKPDVIHLHSSKAGAIGRIAFNGKIPMFYTPHG
YSFLMEDCKPMKRMIYKMVEKICAKRKCTTISCSMGEHQETLKLTKRATYVSNGINMEEL
QSIIDKTEKVAHPFTVFTLGRICYQKNPTLFNEIAERLPNVRFIWIGDGELRENLKSPNI
VITGWVERSMAIKYAVNADIFILPSRWEGLPISLLEAMYMKKICVVSDVIGNRDVIDNGK
NGFVCSNADQFVEIIHEAQNEPKEIREQAHKDILAVYNTKVMAKQYSEKYREALNCV

Enzyme Prediction     

No EC number prediction in MGYG000002304_01575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	186	324	1e-23	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	6.63e-72	6	347	1	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	1.24e-50	6	351	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.58e-38	15	355	14	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	6.35e-37	6	329	1	335	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03819	GT4_WavL-like	3.46e-31	7	302	1	300	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL26457.1	1.24e-205	1	355	1	355
BBH27396.1	2.71e-204	1	355	1	355
ARE22188.1	1.08e-202	1	355	1	355
AEV69377.1	1.11e-167	1	354	1	358
AVK50114.1	3.45e-166	3	354	4	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XYW_A	5.94e-08	16	312	14	298	GlycosyltransferasesWbnH [Escherichia coli]
6N1X_A	8.67e-06	37	355	43	376	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	9.06e-06	37	355	59	392	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48453	1.50e-20	7	324	3	332	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q8S4F6	6.49e-10	81	347	182	478	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
O32272	2.85e-09	86	351	105	382	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1
Q0P9C9	4.88e-09	54	357	46	376	N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglA PE=1 SV=1
P71053	6.62e-09	73	326	62	342	Putative glycosyltransferase EpsD OS=Bacillus subtilis (strain 168) OX=224308 GN=epsD PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000089	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26