CAZyme Information: MGYG000002305_02690

Basic Information

• Species: Leminorella grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella grimontii
• CAZyme ID: MGYG000002305_02690
• CAZy Family: GH25
• CAZyme Description: Lysozyme M1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000002305_9|CGC1	28670.76	6.4951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002305	4219592	Isolate	not provided	not provided

• Gene Location: Start: 53531; End: 54271 Strand: -

Full Sequence      

MNRDIMRIRLLLAIACSIAALAAFMVFALYQGVIRFNYPSREEFPIQGIDISHHQKEIDW
DRLNTAEIQFIFIKATEGGNFKDKRFHLNWKDARQRGFVVGAYHFFTFCSSGDEQADNFI
SSVPVEKGTLPPVIDLEYGGNCQLTSGRLEVLKEVEVLSDRLEKAYGQRPILYVTREFYD
DFLIDKMPKSAIWLRDVYRKPGLQPDNRDWLFWQYANRGKLEGIETFVDFNVFNGKKDKF
ETLINN

Enzyme Prediction     

No EC number prediction in MGYG000002305_02690.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	49	224	3.8e-48	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06413	GH25_muramidase_1	5.00e-104	44	235	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	2.33e-58	10	245	14	265	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
cd06524	GH25_YegX-like	2.66e-58	48	235	2	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd00599	GH25_muramidase	1.41e-57	47	233	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	8.58e-51	49	224	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI43433.1	2.12e-144	6	246	1	241
AKJ41073.1	2.12e-109	6	244	1	239
VEJ53388.1	2.12e-109	6	244	1	239
QBH98634.1	4.15e-104	25	246	18	238
QLL57375.1	1.61e-94	30	244	25	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	3.69e-60	42	241	12	214	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	1.47e-26	46	246	5	215	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	9.21e-19	46	233	20	207	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	4.63e-18	46	233	20	207	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
6ZM8_A	8.57e-16	46	245	2	206	ChainA, muramidase [Sodiomyces alcalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	2.38e-37	30	244	51	265	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	2.38e-37	30	244	51	265	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
Q8FFY2	9.30e-37	30	244	51	265	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P25310	3.94e-25	46	246	82	292	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	5.42e-16	46	233	9	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999985	0.000032	0.000002	0.000000	0.000000	0.000006

TMHMM  Annotations     

start	end
12	34