CAZyme Information: MGYG000002306_00368

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_00368
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		57926.5	8.7901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 1726; End: 3312 Strand: +

Full Sequence      

MSAPPRESPVHTDGAETERVVPVVSPGPLVPAADFGPTDDVRGWVVTGVVTLVAAVTRFV
NLGSPTDGGTPVFDEKHYAPQAWQVLHNHGVEDNPGFSLVVHPPVGKQLIAIGEALFGYN
GVGWRFTGALLGVVMVALVVRIVRRISRSTLVGAIAGVLVICDGVSFVASRTALLDGILT
FFVVAAFGALIVDRDQVRQRLHTALLQGRSADTVWGPRLGVRWWRFGAGVLLGLACGTKW
SGLYFVLFFAAMSLAFDVAARRQYQVTRPWLGVVRRDLLPTGYALGFIPAAVYLAGYAPW
FASETAIDRHEVGQTIGPRSVLPLPDAIRSLWHYTAKAFQFHAGLTNSAGNYHPWESKPW
SWPMSLRPVLYAIDEQNVPGCGAQSCVKAEMLVGTPAMWWLAVPVLVFALWRMLVRRDWR
YAAVLVGYCAGWLPWFADIDRQMYFFYAATMAPFLAMAIALICGDILYAPTATGVLRANS
ERRTLGLIAVCCYVALVVTNFAWLFPVLTGLPISQQTWNMEIWLPSWR

Enzyme Prediction     

No EC number prediction in MGYG000002306_00368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	49	301	9.6e-77	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.19e-118	29	528	25	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.53e-21	49	301	2	241	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	2.46e-13	102	467	136	413	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	3.17e-11	329	525	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1807	ArnT	1.02e-10	102	274	64	212	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASF95199.1	0.0	1	528	1	528
ANH27754.1	0.0	1	528	1	528
AJK76075.1	0.0	1	528	1	528
ASE16050.1	0.0	1	528	1	528
AZA68212.1	0.0	1	528	1	528

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN05	0.0	1	528	1	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
P9WN04	0.0	1	528	1	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
L8F4Z2	6.12e-294	10	528	4	516	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.01e-135	49	528	40	520	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q9W5D4	2.75e-09	44	247	40	235	Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999164	0.000817	0.000004	0.000002	0.000001	0.000002

TMHMM  Annotations     

start	end
121	143
150	169
173	192
228	250
279	301
393	415
442	464
485	507