CAZyme Information: MGYG000002306_00372

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_00372
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720		75783.65	9.0697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 1174; End: 3336 Strand: +

Full Sequence      

MTPRPESLASSPQPVERRGSRRGFRPDIEGLRAVAVIAVVLYHAGIPGIGGGYIGVDVFF
VISGFLITGLLFREASTTNTVALGRFYGARARRLLPAAAIVGTVTAIGAAAVLPPLQARS
VFLDGVASALYVGNYRFALRGTDYLTADAPSPFQHYWSLGVEEQFYLVWPLLIIAVAASV
RRVRPLRATPRPVPYAVVLALIGAASLVAGVLWTRTSPSWAFFSLPTRAWELAAGGLVAL
SIQQWRRLSLRTASIARWGGLALILLTCTQLNAHTPYPGTEALLPVLGTALIIGGGAVTG
GLGPGRLLCRPAMRAIGRISYSWYLWHWPVLLLMPALLGEPAGLPARLSATAVSAGLAVL
TLHLVENPGRFAAALRRSAKVSLVVAGGASAATACACLVLLNVIPAPVGHGVAAPRANII
ATPPSNVPAISAQEAAVRQAFAQARVILAAAAGVRAVPSNLDPPLAQAPANKAAVFVNGC
VRSWRDVGQSECATGDTASPTTVALIGDSHAAMWNPAFEQLAGQRHWRLETLAKVTCPLA
ELHIVSPYLGREYTECEQWRAQIMARMNAEHPRLVVLDMSRRYGADFGFTSYDPAWIDTL
GRTVAQLRGTGATVLVLGPSPDPHSSAPVCLSAHLDDVTACAPTRSAAIDGDGVAAEQAA
TLGNGGHYADLSDLFCTPDRCPLIVGNTLVFRDDNHVTTEYARLLAPVLGALADRALAEG

Enzyme Prediction     

No EC number prediction in MGYG000002306_00372.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1835	OafA	4.89e-55	17	394	7	382	Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains [Cell wall/membrane/envelope biogenesis].
pfam19040	SGNH	2.57e-27	486	709	7	233	SGNH domain (fused to AT3 domains). This entry include SGNH domains that are found fused to membrane domains from the AT3 families pfam01757.
pfam01757	Acyl_transf_3	2.25e-22	25	360	1	323	Acyltransferase family. This family includes a range of acyltransferase enzymes. This domain is found in many as yet uncharacterized C. elegans proteins and it is approximately 300 amino acids long.
NF033760	gliding_GltG	0.001	365	474	96	199	adventurous gliding motility protein GltG. GltG proteins, including the founding member MXAN_4867 from Myxococcus xanthus, occur in certain delta-proteobacteria and are involved in adventurous gliding (A-)motility. GltG has an N-terminal forkhead-associated (FHA) domain domain, often associated with signal transduction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNA71339.1	5.28e-125	23	715	45	726
BAG21593.1	9.23e-124	21	712	59	733
QEU77614.1	1.00e-123	21	705	44	712
QNQ36362.1	1.70e-122	21	712	54	728
QKW43128.1	6.53e-121	1	712	18	709

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8Y7I6	4.22e-32	22	370	9	357	Peptidoglycan O-acetyltransferase OatA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=oatA PE=1 SV=1
O05402	2.62e-30	24	370	10	357	Putative peptidoglycan O-acetyltransferase YrhL OS=Bacillus subtilis (strain 168) OX=224308 GN=yrhL PE=3 SV=1
Q6GIB3	1.63e-27	24	331	15	320	Putative O-acetyltransferase SAR0937 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0937 PE=3 SV=1
Q99VB6	1.63e-27	24	331	15	320	Putative O-acetyltransferase SAV0974 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0974 PE=3 SV=1
Q7A1B1	1.63e-27	24	331	15	320	Putative O-acetyltransferase MW0856 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0856 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999950	0.000044	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
28	46
51	73
94	116
165	180
193	215
220	242
255	277
287	309
322	339
343	365
382	404