CAZyme Information: MGYG000002306_00642

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_00642
• CAZy Family: GT2
• CAZyme Description: Dimodular nonribosomal peptide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1442	MGYG000002306_58|CGC1	153992.63	4.7706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 53387; End: 57715 Strand: -

Full Sequence      

MAEQVSVLTQTPSAVAALPADGLESVALVVVGEACPVEVVDRWAPGRVMVNAYGPTETTM
CVAISAPLKPGSGVPPIGAPVSTAALFVLDRWLRPAPPGVVGELYVAGAGVAVGYTNRAG
LTGSRFVACPFGAPGTRMYRTGDLVRWRADGQLDYLGRADEQVKIRGYRIELGEIRSALV
GLDGVEQAAVIAREDRPGDKRLVAYVTESATGTADPAEIRARLAQRLPEYMVPAAVVVLE
TLPLTANGKLDTRALPAPGYQNSDHRAPSSPVEEILAGVFADVLGLDRVGVDDSFFDLGG
DSLVATRLIAAIETTLNADLSVRAVFEAPTVSQLALCVGSDRGRREPLVAVERLAVVPLS
FAQQRLWFIDQLQGPSPIYNMAAALRLTGRLDADALGTALADVVARQETLRTLFPAVDGI
PEQVVIPAERADFGWQVVDATGWPTDRLQQAIEATVRHSFDLATEIPLRARLFRIADDEH
VLVAVLHHIAADGLSMAPLVADLGMAYASRCAGHAPGWAPLPVQYADYSLWQRALLGDVA
DAESPMAAQLAYWEQQLAGLPERLALPTDRPYPPVADYRGASVMVEWPTELQQRVRTVAR
EHNATSFMVIQAALAVLLAKLSASRDLATGFAIAGRREPALDELVGFFVNTLVLRVDLAG
DPSFTESLAQVRARSLAAYDHQDVPFEVLVERLNPTRSLAHHPLVQVVLAWQNFAREDGV
PAGLALGDLQVTPLAADTQVARMDLTFTLGERWTSAGEPAGIGGSVEFRTDVFDAERIPT
LIQRLERVLAAMTADPGQRLSSVDLMDTDEHIYLDEIGNREALTQPAARVSIPAMFADQV
IRAPQAVATRCAGHSMTYRKLDEASNRLAHLLIEAGAGPGESVALLFNRRAEAVVAVLAV
LKTGAAYLPIDPAHPTARIEFMVADAAPIAAITTTELAERLDGCGLPIIDIADPRIDSYP
HTALPVPDPDDIAYLIYTSGTTGVPKGVAITHNNVTELLGSLAPDLARPGQVWSQWHSYS
FDISGWEIYGALLHGGRLVVVPEEVAASPDDLHALLIDEKVTVLCQTPSAAGTLSPQGLE
SVTLLVGGEACPSELVERWGPGRVMINEYGPTETTMWVALSAPLTAGSTGSDAVPIGSPV
PGAAFFVLDQWLRPVPAGVVGELYVAGTGVGVGYVRRAGLTASRFVACPFGESGTRMYRT
GDLVRWGADGQLRYLGRADEQVKIRGYRIELGEIRSALAGLDGIEQAAVIAREDRPGDKR
LVGYVTESVTGAADPADIRARLGQRLPAYMVPAAVVVLDALPLTVNGKLNARALPAPEYI
ERERYCAPATPTEETLAGIYAQVLGLERVGVDDSFFDLGGDSLSAMRVIAAINKTLDAGL
AVRTLFHAPSVRGLCRQLGQGADEVENQVEIIPRRVPQGGHRRSAVLHSSRERAELAVSR
SR

Enzyme Prediction     

No EC number prediction in MGYG000002306_00642.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12467	PRK12467	0.0	350	1418	46	1117	peptide synthase; Provisional
cd19540	LCL_NRPS-like	0.0	356	796	1	433	LCL-type Condensation domain of nonribosomal peptide synthetases (NRPSs) and similar domains. LCL-type Condensation (C) domains catalyze peptide bond formation between two L-amino acids, ((L)C(L)). C-domains of NRPSs catalyze peptide bond formation within (usually) large multi-modular enzymatic complexes. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). In addition to the LCL-type, there are various subtypes of C-domains such as the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and heterocyclization (Cyc) domains which catalyze both peptide bond formation and cyclization of Cys, Ser, or Thr residues. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain. C-domains typically have a conserved HHxxxD motif at the active site; mutations in this motif can abolish or diminish condensation activity. An HHxx[SAG]DGxSx(6)[ED] motif is characteristic of LCL-type C-domains.
PRK12316	PRK12316	0.0	358	1408	51	1094	peptide synthase; Provisional
PRK12316	PRK12316	0.0	28	1401	2266	3627	peptide synthase; Provisional
PRK05691	PRK05691	0.0	32	1396	1397	2773	peptide synthase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND46664.1	2.11e-297	21	1394	1268	2658
ACX49739.1	1.36e-204	12	1099	719	1847
BAY90071.1	5.34e-194	266	1402	2131	3290
BAY30132.1	1.80e-193	266	1398	2142	3294
BAZ75991.1	3.16e-188	266	1398	2140	3292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U89_A	7.54e-214	51	810	312	1066	Crystalstructure of a cross-module fragment from the dimodular NRPS DhbF [Geobacillus sp. Y4.1MC1]
6MFZ_A	2.28e-199	51	1391	481	1790	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
6P1J_A	9.61e-195	358	1314	7	964	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae],6P1J_B The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae]
6MFY_A	4.38e-182	51	1318	481	1716	Crystalstructure of a 5-domain construct of LgrA in the substrate donation state [Brevibacillus parabrevis],6MG0_A Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis],6MG0_B Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis]
6OYF_A	6.06e-165	358	1226	4	873	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module [Eleftheria terrae],6OZV_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with AMP [Eleftheria terrae],6P4U_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with Mg and AMP [Eleftheria terrae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45745	0.0	51	1404	746	2113	Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=dhbF PE=1 SV=4
Q70LM4	3.24e-288	4	1398	3279	4672	Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis OX=54914 GN=lgrD PE=1 SV=1
Q70LM5	7.69e-285	3	1399	5873	7271	Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis OX=54914 GN=lgrC PE=3 SV=1
Q70LM6	2.97e-267	51	1413	3320	4692	Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis OX=54914 GN=lgrB PE=1 SV=1
P0DUV3	5.64e-258	46	1397	1771	3126	Malpicyclin synthetase OS=Mortierella alpina OX=64518 GN=mpcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999036	0.001011	0.000002	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002306_00642.