CAZyme Information: MGYG000002306_01131

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_01131
• CAZy Family: GH16
• CAZyme Description: Glucan endo-1,3-beta-glucosidase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273		29986.38	5.1055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 11047; End: 11868 Strand: +

Full Sequence      

MPEIDRRRMIVTTGIGVLAAALPNPRAGASPAPPPAAPSGQSGTYLFQDEFDGPAGSAPD
ASKWAVAKARETIKDPTYWERPENIGQYRDDRRNVFLDGKSNLVLRAAKNGPTYYSGKVQ
SLWRGGVGHTWEARIKLDCLTAGAWPAYWLGNDDQGEIDVMEWYGNGNWPSATTVHAKAN
GGEWKTHNIAVDSAWHTWRCQWDEAGIRFWKDYVDGAQPYFDVPASSLPDWPFNGPGYTV
FPVFNLAVAGSGGGDPGPGSYPADMLIDWIRVW

Enzyme Prediction     

No EC number prediction in MGYG000002306_01131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	48	273	4.7e-126	0.9956331877729258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.34e-32	47	273	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	2.60e-21	49	273	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	3.86e-15	44	230	3	210	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	4.27e-10	94	216	4	122	Glycosyl hydrolases family 16.
cd02178	GH16_beta_agarase	5.03e-10	49	273	27	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASE15417.1	6.79e-217	1	273	1	273
ANH28413.1	6.79e-217	1	273	1	273
AYQ70249.1	6.79e-217	1	273	1	273
AGL37080.1	6.79e-217	1	273	1	273
AJK79623.1	6.79e-217	1	273	1	273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XXP_A	9.90e-193	36	273	16	253	CrystalStructure of an Uncharacterized Protein (Rv0315 ortholog) from Mycobacterium paratuberculosis [Mycobacterium avium subsp. paratuberculosis K-10]
4PQ9_A	2.11e-163	37	273	21	257	CrystalStructure of a Beta-1,3-glucanase from Mycobacterium marinum [Mycobacterium marinum M],4PQ9_B Crystal Structure of a Beta-1,3-glucanase from Mycobacterium marinum [Mycobacterium marinum M]
3RQ0_A	5.46e-155	3	273	6	269	Thecrystal structure of a glycosyl hydrolases (GH) family protein 16 from Mycobacterium smegmatis str. MC2 155 [Mycolicibacterium smegmatis MC2 155]
4W65_A	1.50e-152	1	273	1	279	ChainA, Glycosyl hydrolase family protein [Mycolicibacterium fortuitum subsp. fortuitum DSM 46621 = ATCC 6841 = JCM 6387]
5DXD_A	2.31e-123	33	273	14	257	Crystalstructure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abscessus [Mycobacteroides abscessus ATCC 19977],5DXD_B Crystal structure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abscessus [Mycobacteroides abscessus ATCC 19977]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000040	0.000002	0.996768	0.003186	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002306_01131.