CAZyme Information: MGYG000002306_01884

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_01884
• CAZy Family: GT1
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
151	MGYG000002306_157|CGC1	17352.41	9.9811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 3905; End: 4360 Strand: +

Full Sequence      

MGRLLLIASSGGHIYEMFCLREFWQDKDRFWVSFATADARYLLRDEPEVYWAAHPTVRSV
PNLLRNLVLALRLLTRHRPAMILTTGSGVAAPFIWLAWLLRIPAVFVESVTRITELSLTA
RMVKPFASHLLVQWPELAERIPAAEYHGRIV

Enzyme Prediction     

No EC number prediction in MGYG000002306_01884.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08660	Alg14	1.03e-22	4	150	1	171	Oligosaccharide biosynthesis protein Alg14 like. Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane.
COG0707	MurG	1.56e-12	2	144	1	154	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	7.37e-07	63	144	74	152	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	1.32e-04	57	144	70	154	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJK80256.1	3.89e-106	1	151	1	151
ATO70861.1	3.89e-106	1	151	1	151
AYQ69611.1	3.89e-106	1	151	1	151
AJK76063.1	3.89e-106	1	151	1	151
QPM72238.1	3.89e-106	1	151	1	151

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6CF02	8.46e-14	66	151	125	216	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG14 PE=3 SV=1
Q5A5N6	8.84e-10	3	151	49	219	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG14 PE=3 SV=1
Q9D081	1.66e-09	3	151	38	217	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Mus musculus OX=10090 GN=Alg14 PE=1 SV=1
Q6AY85	1.15e-08	36	151	95	216	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus OX=10116 GN=Alg14 PE=2 SV=1
Q96F25	2.19e-08	59	151	118	216	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens OX=9606 GN=ALG14 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
80	102