CAZyme Information: MGYG000002306_02326

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_02326
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		42796.4	10.3475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 478; End: 1662 Strand: +

Full Sequence      

MAAPLLLVASVAARLAWTYLVPNGANFVDLHVYLGGAAALDHPGTLYSYVYADQTPDFPL
PFTYPPFAAIVFYPLHLLPFGLVALGWQLATIAALYGAVRISQRLLGVPAGAHGRRVAMV
WTAVTIWIEPLRSTFDYGQVNVLLMTAVLWAVYSTRWWLSGLLVGLAAGIKLTPAVTGVY
LAGARRWAATMFSAVIFLATIGISVLVVGDQTRYYFTELLGDAHRVGPIATSFNQSWRGG
LSRILGHDVGFGPLLVTAVAGTAVLAVLAWRALDRSDRLGRLIVVEVFGLLLSPISWTHH
WVWLVPLMIWAIHGPVRAWRGARLVGWGWLALTVIGVPWLLSFAQPNIWQIGRPWYLAWA
GLVYIVAAVATLVWIAAAGRRAGHQVTAPSVTPA

Enzyme Prediction     

No EC number prediction in MGYG000002306_02326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	62	294	1.9e-72	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	0.0	1	394	18	409	mannosyltransferase; Provisional
pfam09594	GT87	9.43e-32	62	294	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJK78773.1	6.41e-289	2	394	45	437
QQW59374.1	6.41e-289	2	394	45	437
AGL36131.1	6.41e-289	2	394	45	437
AAS04941.1	6.41e-289	2	394	45	437
AZP80657.1	6.41e-289	2	394	45	437

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN00	5.26e-223	2	380	43	420	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	5.26e-223	2	380	43	420	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1
A0R2K8	4.24e-210	3	383	32	410	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WMZ8	1.13e-34	28	373	45	400	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	1.13e-34	28	373	45	400	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.865584	0.133112	0.000631	0.000269	0.000154	0.000254

TMHMM  Annotations     

start	end
77	99
137	154
158	180
187	209
249	270
282	304
324	343
355	377