CAZyme Information: MGYG000002306_02737

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_02737
• CAZy Family: GH16
• CAZyme Description: Glucan endo-1,3-beta-glucosidase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000002306_261|CGC1	29538.22	4.4314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 2328; End: 3134 Strand: +

Full Sequence      

MMLMSGIGMLGAAMRLPGAWATPPAPEAPPSAGGGPYIFADEFDGPAGSPPDPGKWTIQT
WQDDVFPPVAGIYRDDRRNVFQDGNSNLVLCATQEMGTYYSGKLRGNFRSMINQTWEARI
KLDCLFPGLWPSFWGVNEDPLPDGEVDIFEWYGNGQWPPGTTVHAASNGKTWEGKSIPGL
VDGNWHTWRMHWGEEGFEFSRDGAEYFKVPNKPIHVAGGAPDDFRWPFNNPGYWMTPMFT
LAVGGVGAGDPAAGVFPSSMLIDYIRIW

Enzyme Prediction     

No EC number prediction in MGYG000002306_02737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	41	268	1.4e-105	0.9912663755458515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	3.02e-32	39	268	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.30e-16	41	268	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	4.53e-15	38	268	5	258	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	1.15e-09	79	266	4	168	Glycosyl hydrolases family 16.
COG2273	BglS	1.41e-04	39	261	53	291	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKU47365.1	9.26e-217	1	268	1	268
AGL38758.1	1.12e-216	1	268	6	273
ASE13072.1	1.12e-216	1	268	6	273
QBC87148.1	1.12e-216	1	268	6	273
QCR81647.1	1.12e-216	1	268	6	273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WZF_A	7.04e-88	1	268	11	294	Crystalstructural basis for Rv0315, an immunostimulatory antigen and pseudo beta-1, 3-glucanase of Mycobacterium tuberculosis [Mycobacterium tuberculosis H37Rv],4WZF_B Crystal structural basis for Rv0315, an immunostimulatory antigen and pseudo beta-1, 3-glucanase of Mycobacterium tuberculosis [Mycobacterium tuberculosis H37Rv]
4XXP_A	7.66e-86	28	268	16	253	CrystalStructure of an Uncharacterized Protein (Rv0315 ortholog) from Mycobacterium paratuberculosis [Mycobacterium avium subsp. paratuberculosis K-10]
4PQ9_A	2.49e-85	26	268	17	257	CrystalStructure of a Beta-1,3-glucanase from Mycobacterium marinum [Mycobacterium marinum M],4PQ9_B Crystal Structure of a Beta-1,3-glucanase from Mycobacterium marinum [Mycobacterium marinum M]
5DXD_A	8.14e-84	26	268	15	257	Crystalstructure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abscessus [Mycobacteroides abscessus ATCC 19977],5DXD_B Crystal structure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abscessus [Mycobacteroides abscessus ATCC 19977]
4W65_A	2.69e-82	1	268	9	279	ChainA, Glycosyl hydrolase family protein [Mycolicibacterium fortuitum subsp. fortuitum DSM 46621 = ATCC 6841 = JCM 6387]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.066606	0.931338	0.000613	0.000740	0.000365	0.000310

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002306_02737.