CAZyme Information: MGYG000002306_03885

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_03885
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		35164.35	8.5132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 13650; End: 14618 Strand: +

Full Sequence      

MLDPVRAKRVLVWHVHGSWTQSFVAGRHRYLIPVAPDRGPDGIGLAGRCWPNAREVAFED
LADRDIDLVVLQRPHEAELVARWAGRRVGVDVPAVYVEHNTPRPSAAQTRHPLADRADIP
LVHVTDFNRLMWDNGIAPTRVIDHGVADPGRLYSGEIPRVATMINEPGRRGRVVGADLLE
PLSAYAQIDVWGIGTEGLCANRGAVRGRGDVPTPRLFGDVARRRVYLHTARWTSLGLSLI
EAMLLGMPVVAVGSTMAPFVIPCEAGVVSADPARLGEGLRGFLDDQARAVAAGKAARDFA
TARFGLKRFLADWDQVIGELCR

Enzyme Prediction     

No EC number prediction in MGYG000002306_03885.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0438	RfaB	7.04e-07	6	322	27	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	6.64e-06	222	286	78	145	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03802	GT4_AviGT4-like	1.16e-04	22	281	46	300	UDP-Glc:tetrahydrobiopterin alpha-glucosyltransferase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.
cd03801	GT4_PimA-like	2.43e-04	202	317	247	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13692	Glyco_trans_1_4	0.002	224	285	75	138	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZP80062.1	2.16e-240	1	322	1	322
AYQ78875.1	2.16e-240	1	322	1	322
ASF97300.1	2.16e-240	1	322	1	322
AZB39427.1	2.16e-240	1	322	1	322
AYQ67708.1	2.16e-240	1	322	1	322

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002306_03885.