CAZyme Information: MGYG000002307_01499

Basic Information

• Species: Campylobacter hyointestinalis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter hyointestinalis
• CAZyme ID: MGYG000002307_01499
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38509.52	8.8219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002307	1753385	Isolate	Belgium	Europe

• Gene Location: Start: 1442586; End: 1443617 Strand: -

Full Sequence      

MKILVSCLEASANLHLAEVLKHLKNSEICGIFDKKFGEVLYDSKEFSAMGFVEILPLIFK
AKKALKQMVLLAENCDKVLLIDSPAFNLPLAKAIKEAGLKCEITYYILPQVWAWKSGRVA
KVEKYCDNLASILPFDASFYSRSNYVGHPLLDEIKVQKRELLNSQIVAFLPGSRKSEITK
LMPVYKEVALSLNGKKLLVVPPNLKNDIDEIYGDVSEFQVVFDTHKALLQSEFAFVCSGT
ATLEAALIGTPFVLCYKAKAIDIWLARKLVKLKHVGLANIIFDFMGKEALNVELIQEQVS
KKALLDEYKNCDKSKFLRACKELRDYLKHGSAKKVADILLSQI

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	315	2e-92	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	0.0	1	342	2	347	lipid-A-disaccharide synthase.
COG0763	LpxB	8.99e-104	1	340	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.65e-86	3	336	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.93e-82	3	339	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	1.68e-79	1	343	2	375	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKF56262.1	2.97e-244	1	343	1	343
ANE33092.1	4.17e-244	1	343	10	352
QCU00468.1	6.71e-241	1	343	1	343
AJB44976.1	8.50e-223	1	341	1	341
AVK80598.1	8.50e-223	1	341	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.20e-25	81	304	97	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.65e-25	81	304	97	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FK76	7.76e-119	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q5HWH9	7.76e-119	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
Q9PIK8	1.79e-117	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
O25537	6.84e-101	3	337	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=lpxB PE=3 SV=1
Q9ZKY2	1.94e-100	3	337	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002307_01499.