CAZyme Information: MGYG000002308_01175

Basic Information

• Species: Campylobacter lanienae
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter lanienae
• CAZyme ID: MGYG000002308_01175
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742		87688.8	8.9362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002308	1594554	Isolate	Switzerland	Europe

• Gene Location: Start: 1158253; End: 1160481 Strand: +

Full Sequence      

MALLSIIIPFGTSKERPYIKDRVINKANEYRSNDLIEYIFVEGFSSLEHPELKTLIQSNG
HRYFKDEIQQSNKAFCLGRCRNLGIINANSDVVMSLDVDCIISRKNLESILRLIKIKEID
KNPNAFLILPCIFLNEFGSEILQNYNFDLWDNMLIDDMIYERKFIKFITPASSTFIMNRF
KFLELGGNDNGFVGHGYEDFDLMMRILKNCASFEAMPDNLEFDYRNWSFNDYKGFRALFS
LVGQEACMHGIYLYHLWHIEPNQNGYLDNRELNHKIFYQKLKNYNNIFDDEPDPLIENEA
KNRNALALFTQNSLVYRSLREIMPYFEKFISAKEYIFFNEDDKFDSQIFMKFWMKNNITH
LIFPNSHGNDKRLEILKFLRANNLPYIVFDRGALPDSWFFDEKGFNYDSTSYDEKNWNKP
LNEEQKSKTIAYIQEVLNAKSFLEKQGARQGSEELRRKFGLRHKKIIFIPLQVKNDSVIN
HFTYEPFSYDNFLNILNEVAKKLSIENIAFVVKKHPLSLNADKTAYDNLIFTHDNANLID
LLELCDAVLTLNSGVGLYAILAKKPCIVCANAFYRFDNLNLQAKSKDELLEHILNITDGN
FKFDEDKALRFIHYLRYEFYSFGKSYYKERKEKGRIYTSVYKIEFYSLVLFGKKIFNFNS
LEKQKYRLNSPIYKPYIYEIKNGIKSKNILQNTNYKNAIQAKFSHLKFYRLFRKLITNPK
DFVMDSKNPLMKPIKSILRRSL

Enzyme Prediction     

No EC number prediction in MGYG000002308_01175.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	283	4.5e-82	0.9963768115942029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10111	Glyco_tranf_2_2	2.17e-73	5	283	1	276	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG4092	COG4092	1.91e-60	1	284	1	293	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
cd16438	beta_Kdo_transferase_KpsS_like	4.09e-27	380	619	19	247	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS like. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
pfam05159	Capsule_synth	2.17e-09	380	582	21	274	Capsule polysaccharide biosynthesis protein. This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS and LipB.
cd16436	beta_Kdo_transferase	1.63e-07	443	574	49	183	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. KpsC and KpsS are retaining beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferases. They are part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ97898.1	0.0	1	742	1	742
ANE34504.1	0.0	1	742	1	741
QKF79265.1	0.0	1	742	1	739
VEJ07650.1	3.54e-268	1	742	1	739
ASN50675.1	9.92e-228	1	728	1	715

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002308_01175.