CAZyme Information: MGYG000002309_01413

Basic Information

• Species: Kurthia senegalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Kurthia; Kurthia senegalensis
• CAZyme ID: MGYG000002309_01413
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	MGYG000002309_19|CGC1	26415.84	8.9135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002309	2976740	Isolate	Senegal	Africa

• Gene Location: Start: 10822; End: 11538 Strand: +

Full Sequence      

MKKKSKRLNWIIGIAIAFFIIGIGAVIGVYQLFEAEKTSLSAPSAKDQAREEFLGTIGET
AREVAANHDLYASVMIAQASLESHFGTSGLGSSPNFNLYGIKGQYENKSVQFDTQEDDGK
GNMTTVKADFRKYPSYEASMDDYANLLAKGTSWDPTIYKEAFKTNARTYLEATNALTGTY
ATDSSYEKKLNALIAQYHLDAYDTVATKKQSKWAFSIMWKMSLLRTPSNRHSFVSGII

Enzyme Prediction     

No EC number prediction in MGYG000002309_01413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	58	199	1.3e-27	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	3.45e-60	45	203	315	472	amidase domain-containing protein.
PRK06347	PRK06347	4.76e-57	51	204	151	304	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	3.40e-50	41	207	34	192	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.44e-23	48	203	6	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	6.03e-21	58	149	1	84	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV11333.1	6.43e-68	1	209	1	206
QAS59149.1	1.15e-65	8	211	5	207
QDZ99684.1	1.15e-65	8	211	5	207
QIC49904.1	1.15e-65	8	211	5	207
AJK88311.1	1.15e-65	8	211	5	207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.48e-44	29	203	9	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	5.65e-39	52	217	62	226	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	5.07e-10	53	194	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.91e-10	53	194	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.00e-09	53	194	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G222	1.37e-37	52	217	322	486	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	1.30e-32	48	204	178	334	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	3.61e-32	45	203	57	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	7.14e-32	45	203	57	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	9.66e-32	45	203	57	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.975659	0.014822	0.000484	0.000154	0.000078	0.008814

TMHMM  Annotations     

start	end
7	29