CAZyme Information: MGYG000002310_00565

Basic Information

• Species: Microvirga massiliensis
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Microvirga; Microvirga massiliensis
• CAZyme ID: MGYG000002310_00565
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		68361.75	9.4366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002310	8892798	Isolate	not provided	not provided

• Gene Location: Start: 572122; End: 573978 Strand: +

Full Sequence      

MTTILPDRGTGPITEIAGAAGAPRLEPLHSRFQKLEYLAWCALWVLALGSFWIWWFDPAH
KIGLGPFILITLVLAWITLLPIYFLLIYFGARRQIGPLCLPPASRVAMVVTKAPSEPFSV
VRQTLEAMLDQDLPHDTWLADEDPAPETLAWCAARGISISTRRGRPDYHRATWPRRTRCK
EGNLAYFYDHFGYERYDFVVQLDADHVPTRTYLREMLKPFADPRVGYVSAPSICDLNARE
SWSARGRLYLEASLHGALQAGYNGGWAPLCIGSHYAVRTKALRECGGLGPELAEDHSTTL
MLNASGWRGVHAIDAIAHGDGPRTFADLATQEFQWSRSLVTILLQYAPTLVRRLPPRLKF
QFLFSQLWYPLFSLSMAIMFALPIIALLSGRNFVSVSYPDFLTRFVPISAVLVLMALRWR
AAGHYRPCDAKVLSWEGTLFLFARWPWSLWGCIMAVRDWTTGSFVDFRVTPKGNGKVGPL
PLRVIAPYAILALISALPPLLVADAGAARGFYAFAILNAFVYAGLFCAIVLLHALENALP
LLEAPRPILAQAAIAAILLFLPAVATTTRGPSGVEALTWGAPGLQLTHAEFRVAGAGQGG
AALRKVRFRSWSAIPRTG

Enzyme Prediction     

No EC number prediction in MGYG000002310_00565.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	199	385	7.2e-18	0.9543147208121827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	3.71e-71	105	343	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	4.75e-55	55	477	3	437	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13506	Glyco_transf_21	1.44e-22	195	337	31	174	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.
cd06423	CESA_like	3.63e-16	120	295	11	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06435	CESA_NdvC_like	5.81e-15	115	347	8	236	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASP99590.1	1.69e-285	3	615	2	610
AIM03602.1	1.69e-285	3	615	2	610
ASQ07291.1	1.69e-285	3	615	2	610
ASQ14707.1	2.40e-285	3	615	2	610
AEG08503.1	1.96e-284	3	615	2	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	3.74e-10	152	446	197	461	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.92e-10	152	446	209	473	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.93e-10	152	446	210	474	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	3.69e-09	55	342	224	504	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L7	1.53e-08	21	342	186	504	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	2.01e-08	55	342	224	504	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q93IN2	1.81e-07	55	342	224	504	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	2.38e-07	55	342	224	504	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P58931	1.54e-06	115	342	169	390	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999963	0.000035	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	56
66	88
367	386
401	419
432	454
484	503
510	532
547	564