CAZyme Information: MGYG000002310_03060

Basic Information

• Species: Microvirga massiliensis
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Microvirga; Microvirga massiliensis
• CAZyme ID: MGYG000002310_03060
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000002310_4|CGC1	25801.12	11.1304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002310	8892798	Isolate	not provided	not provided

• Gene Location: Start: 401053; End: 401760 Strand: -

Full Sequence      

MSFARILRRVVRLILGIALLWGLAVLLLGLAYRVVPPVSTLMAGRWLTGAEVRRDWTDLK
GISRQLPLAVIASEDGRFCLHEGVDWDALWSVIEAADGNGPSRGASTIAMQTAKNLFLWP
SRSYVRKGLELPIALYLDLVWPKQRVIEVYLNIAEWGEGIFGAEAAARTYFRKSATQLTR
REAALLATALPNPLARNPARPSAQHRALAARVLQRMNGTPADCLSPGSGLRAPRA

Enzyme Prediction     

No EC number prediction in MGYG000002310_03060.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	51	217	3.6e-49	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	4.40e-98	4	217	2	224	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	3.20e-68	32	216	25	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.69e-64	1	216	15	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	3.28e-63	51	217	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.50e-31	50	216	63	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM30044.1	4.28e-101	1	226	1	228
QFU17778.1	1.23e-100	5	224	36	257
ANY81830.1	1.47e-96	15	226	3	216
APF38817.1	2.16e-85	6	224	5	219
ALA17408.1	1.03e-84	6	224	31	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U2G_A	2.18e-19	51	198	37	185	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
2OQO_A	4.25e-18	53	198	19	165	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	4.25e-18	53	198	19	165	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	2.93e-16	53	187	26	161	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	7.42e-16	53	187	35	170	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q13ED9	3.77e-64	28	215	22	210	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain BisB5) OX=316057 GN=mtgA PE=3 SV=1
Q2J2T4	1.01e-63	8	215	2	211	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=mtgA PE=3 SV=1
B6IWJ6	4.59e-63	18	216	13	215	Biosynthetic peptidoglycan transglycosylase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=mtgA PE=3 SV=1
B3QBD2	3.05e-62	8	215	12	220	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain TIE-1) OX=395960 GN=mtgA PE=3 SV=1
Q6NCE7	3.05e-62	8	215	12	220	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35