CAZyme Information: MGYG000002310_04928

Basic Information

• Species: Microvirga massiliensis
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Microvirga; Microvirga massiliensis
• CAZyme ID: MGYG000002310_04928
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	MGYG000002310_8|CGC1	30798.18	10.0937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002310	8892798	Isolate	not provided	not provided

• Gene Location: Start: 208834; End: 209676 Strand: -

Full Sequence      

MRMPVRMMLAVVAGVMGAVVAGPASALTCQDPAGFDKWLGDVRREAAAQGISARAVNAGL
DGVTYDPSIIKRDRGQRFFKQSFEQFSAKMVPLYRVQKGSSLLRQYAGLLSRIEQEFGVP
GPILVAIWGLESDFGAARGKLHTIRSIATLAYDCRRTELFTPQLFDALRIIQRGDLSPDE
MRGAWAGELGQAQFMASNYYRLAVDFDGDGRRDLIRSVPDVLASTANYLKSHGWQRGGSW
EPSTPNAEVLRAWNKSPVYARTIGYFATKLENGASARATR

Enzyme Prediction     

No EC number prediction in MGYG000002310_04928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	35	240	4.1e-79	0.6949152542372882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02283	MltB_2	1.74e-106	34	270	1	298	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam13406	SLT_2	1.08e-105	34	267	1	291	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
COG2951	MltB	6.21e-88	32	267	38	277	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02282	MltB	2.38e-43	42	259	4	225	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK10760	PRK10760	3.58e-33	96	238	125	267	murein hydrolase B; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFU17598.1	1.50e-129	15	270	11	266
ACB96923.1	2.24e-118	23	273	32	282
QBR71788.1	4.56e-117	23	270	19	265
VFU09168.1	1.73e-115	23	270	23	269
ANW02030.1	6.93e-112	16	270	12	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ANZ_A	2.94e-52	21	240	28	253	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]
5AO8_A	2.94e-52	21	240	28	253	CrystalStructure of SltB3 from Pseudomonas aeruginosa in complex with NAG-NAM-pentapeptide [Pseudomonas aeruginosa]
5O8X_A	5.36e-26	95	249	65	217	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	7.13e-26	95	249	82	234	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	1.31e-25	85	237	75	227	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	1.31e-24	85	237	116	268	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000301	0.998988	0.000208	0.000175	0.000157	0.000143

TMHMM  Annotations     

start	end
7	29