CAZyme Information: MGYG000002310_06288

Basic Information

• Species: Microvirga massiliensis
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Microvirga; Microvirga massiliensis
• CAZyme ID: MGYG000002310_06288
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000002310_12|CGC1	82302.19	6.0088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002310	8892798	Isolate	not provided	not provided

• Gene Location: Start: 25342; End: 27549 Strand: +

Full Sequence      

MSEASVKLFPGTIESSPSEELPEFYIEAQTSLVGRPLRTLKSGDSFAVLDAYGDLGIVPD
SPEGLFYRDTRHLSRFELRFDRKRPLFLSSVIQDDNAALTVDLTNPDIWLDDESVTPRDV
IALERTKFLWQGAAYERIGLRNYDSRRHRFRIDLRFDADFRDLFEVRGTERARQGPRTVK
VLGNDRVIFRYEGLDDVVRRTELRFEPSPKRLEEHRAVFDIELEPDERTSIIVTVTCGAG
AIMPSAPPFLMAYRDIRRALRASTADIATVQSSNTLFNEVVCRSTSDLYMLITNTEYGPY
PYAGIPWYSTVFGRDGIITAMLLLWVDPSVAKGVLKYLAATQATTVDPKADAQPGKILHE
RRLGEMAATGEVPFRKYYGTVDATPLFVMLAGQYFERTGDRATIEAIWPNIQAALRWCDE
YGDSDKDGFVEYHRETEQGLANQGWKDSYDSIFHADGTGAEGPIALVEVQGYVFAAKRAA
AQLAIALGETDTATRLEREAETLRRRFEAAFWCEEIGTYALALDGDKKACRVRTSNAGHA
LFTGIAAPDRAQRVAQTLMHQESFSGWGIRTLAKGEPRYNPMSYHNGSIWPHDNALIALG
LARYGRKVDAARVFESVFDAATYQEHRRLPELYCGFLRRRRRGPTAYPVACSPQAWAAAA
PFGFLAACLGLDLAVTSGEVRFLNPVLPNFLDEVVLRGVRLGTSCIDLRLHRYGGDDVTV
NVLSRTGDAQVVLMK

Enzyme Prediction     

No EC number prediction in MGYG000002310_06288.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	364	571	9.4e-18	0.3531746031746032

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	2.38e-142	53	708	31	640	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam14742	GDE_N_bis	5.91e-70	40	231	1	190	N-terminal domain of (some) glycogen debranching enzymes. This domain is found on the N-terminal of some glycogen debranching enzymes and is usually followed by the GDE_C (PF06202) and in this sense it is analogous (but probably not homologous) to the GDE_N (PF12439). Its exact function is unknown
pfam06202	GDE_C	4.83e-11	289	660	9	371	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17389	Bac_rhamnosid6H	5.37e-08	364	587	74	280	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG1626	TreA	1.59e-06	486	633	373	517	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY84137.1	0.0	18	735	17	737
ANY82393.1	0.0	18	735	17	737
QRE77648.1	0.0	13	735	2	754
BAQ47441.1	0.0	13	735	2	754
AWB24403.1	0.0	13	735	2	754

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002310_06288.