CAZyme Information: MGYG000002311_00067

Basic Information

• Species: Vibrio cholerae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio cholerae
• CAZyme ID: MGYG000002311_00067
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002311_1|CGC1	43150.27	9.6353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002311	4089020	Isolate	Haiti	North America

• Gene Location: Start: 73394; End: 74521 Strand: -

Full Sequence      

MRKLVLCITALLLSGCSREFIEKIYDVDYEPTNRFAKNLAELPGQFQKDTAALDALINSF
SGNIEKRWGRRELKIAGKNNYVKYIDNYLSRSEVNFTEGRIIVETVSPIDPKAHLRNAII
TTLLTPDDPAHVDLFSSKDIELKGQPFLYQQVLDQDGQPIQWSWRANRYADYLIANHLKV
KQVDFKKAYYVEIPMVKDQIDIRGYKYASIVRKASRKYDIPEDLIYAIIKTESSFNPYAV
SWANAYGLMQVVPKTAGRDVFKLVKNRSGEPSPEYLFNPENNIDTGTAYFYILKNRYLKE
VRHPTSLEYSMISAYNGGTGGVLSTFSSDRQRAMRDLNALQPNQVYWALTKKHPNAEARR
YLEKVTKFKKEFNAG

Enzyme Prediction     

No EC number prediction in MGYG000002311_00067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	222	369	1.3e-23	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11671	mltC	2.79e-162	1	372	1	356	membrane-bound lytic murein transglycosylase MltC.
cd16893	LT_MltC_MltE	4.18e-100	209	370	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam11873	DUF3393	2.69e-94	46	206	1	161	Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464.
COG0741	MltE	1.46e-48	68	370	6	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK15470	emtA	4.40e-41	203	367	35	198	membrane-bound lytic murein transglycosylase EmtA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV11033.1	1.05e-276	1	375	1	375
AJZ98960.1	1.05e-276	1	375	1	375
QNE70678.1	1.05e-276	1	375	1	375
QTV08053.1	1.05e-276	1	375	1	375
ALJ65109.1	1.05e-276	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	3.55e-110	48	372	14	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	1.01e-109	48	372	14	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	3.82e-31	203	365	18	179	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	1.04e-30	203	365	18	179	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	1.31e-30	203	365	35	196	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N7I2	3.92e-118	40	373	23	356	Membrane-bound lytic murein transglycosylase C OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mltC PE=3 SV=1
A8GJ50	9.89e-114	37	372	20	355	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
Q2NRB3	4.41e-112	36	372	20	355	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1
Q1CEV1	9.15e-112	46	372	29	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mltC PE=3 SV=2
Q1CB94	9.15e-112	46	372	29	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000059	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002311_00067.