CAZyme Information: MGYG000002311_00349

Basic Information

• Species: Vibrio cholerae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio cholerae
• CAZyme ID: MGYG000002311_00349
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
182		20315.09	7.5141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002311	4089020	Isolate	Haiti	North America

• Gene Location: Start: 378234; End: 378782 Strand: -

Full Sequence      

MKTIKAKTVALVIAMSASTSVYAFPGYQWEKAAQSVGIDPVMLYAVALAESASHRGLNMT
SPWPYAIRNGSNATYAKSKTEAEQLLNQALQESEKYQLDIGLMQINLHWHGHRVSSAAEL
LDPITNLTVGSSILAEAIKSSPNDLELGIGRYHSWNEERARWYGQRVLSIYRNILHELEV
RQ

Enzyme Prediction     

No EC number prediction in MGYG000002311_00349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	27	176	2.5e-16	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	7.76e-23	37	173	2	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16892	LT_VirB1-like	7.09e-12	37	137	8	99	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.54e-09	29	154	1	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	9.26e-08	30	174	11	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	2.40e-06	11	139	7	104	type III secretion system invasion protein IagB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ61821.1	3.14e-127	1	182	1	182
ASF15263.1	3.14e-127	1	182	1	182
AYV10758.1	3.14e-127	1	182	1	182
AVH50903.1	3.14e-127	1	182	1	182
SPM19420.1	3.14e-127	1	182	1	182

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.998948	0.000191	0.000193	0.000170	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002311_00349.