CAZyme Information: MGYG000002311_01864

Basic Information

• Species: Vibrio cholerae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio cholerae
• CAZyme ID: MGYG000002311_01864
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		42250.3	7.4236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002311	4089020	Isolate	Haiti	North America

• Gene Location: Start: 2079932; End: 2081071 Strand: -

Full Sequence      

MNRPLRIGIVVGELSGDTLGEGFIKAIRARYPDAEFVGIGGPKMNALGCQSLFDMEELAV
MGLVEVLGRLPRLLKVKAELVKYFTANPPDVFVGIDAPDFNLRLELSLKQAGIKTVHYVS
PSVWAWRQNRIHGIAAATHLVLAFLPFEKAFYDKFNVPCEFIGHTLADSIPLASDKLAAR
QLLGLDEQRRWLAVLPGSRGSEMKMLAEPFIATCQKLQARYPDLGFVVALVNAKRRAQFE
QAWQQVAPELNFVLVDDTARNVITAADAVMLASGTVALECMLLKRPMVVGYRVNAFTAFL
AKRLLKTPYVSLPNILAGEELVKELLQDHCTVDNLYHEVSRLLESDNQALMDKFTEMHQW
IRKDADQQAAQAVLHLIQK

Enzyme Prediction     

No EC number prediction in MGYG000002311_01864.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	362	1.5e-137	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	0.0	4	379	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	4	379	1	377	lipid-A-disaccharide synthase; Reviewed
TIGR00215	lpxB	2.34e-154	7	376	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	4.67e-154	7	373	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	7.19e-46	9	326	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS91703.1	2.39e-275	1	379	1	379
APF72251.1	2.39e-275	1	379	1	379
QTV01474.1	2.39e-275	1	379	1	379
QJS88088.1	2.39e-275	1	379	1	379
ALJ63367.1	2.39e-275	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.86e-150	3	378	5	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.33e-149	3	378	5	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5F627	4.77e-276	1	379	1	379	Lipid-A-disaccharide synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lpxB PE=3 SV=1
Q9KPW5	4.77e-276	1	379	1	379	Lipid-A-disaccharide synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=lpxB PE=3 SV=1
C3LQ19	4.77e-276	1	379	1	379	Lipid-A-disaccharide synthase OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=lpxB PE=3 SV=1
Q8DBE8	1.27e-230	2	379	3	380	Lipid-A-disaccharide synthase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lpxB PE=3 SV=1
Q7MIH2	1.27e-230	2	379	3	380	Lipid-A-disaccharide synthase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002311_01864.