CAZyme Information: MGYG000002312_01530

Basic Information

• Species: Blautia_A sp000285855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp000285855
• CAZyme ID: MGYG000002312_01530
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000002312_29|CGC1	66007.66	9.6243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002312	4168980	Isolate	France	Europe

• Gene Location: Start: 13969; End: 15690 Strand: -

Full Sequence      

MDNKEVVMSKKKTIGVITGIAVGTTVVAARIMKKKAKKTTYKVENIDSVPVRKRGFYEKY
IKRVCDVICATGAIVCFSPLYICVAVLVKLKLGSPVLFTQDRPGLIDKDGKETIFKMYKF
RTMTDERDENGDLLPDEVRLTKFGKWLRNTSLDELPEAFNILNGTMSVIGPRPQLVRDMV
FMTSEQRMRHTAKPGLSGLAQVNGRNAIFWENKMEWDLKYIKKVSLHEDIKIIFKTVEKA
FIKQEGITEENMATAENLGDYLLKNERITSEEYNQKQLEAKKILNRTKDKKIRDEKRITA
VETGAKNKKYSVLMSLYKKEKPEYLKLALDSMLNQTVIPDEIVLVEDGPLTDELYAVLNE
YPMLHRVKNETNLGLGLALNVGLKECRNELVARMDTDDCSKPDRCEKQLARFAEKPYLAI
VGSHIDEFVGDISNVVSQRIVPTSSDEIYNYAKKRSAFNHPAVMYSKTAVLENDGYADLK
RNQDVDLFGRMQFEGYKAENIDEALLWFRSSDELAKRRKSWQNTWSYIATIRKFWKMGYA
SFYDYVMIGIAQTGMYLMPIKIQNYIYKKFLRK

Enzyme Prediction     

No EC number prediction in MGYG000002312_01530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	311	469	5.5e-22	0.9294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	4.13e-82	311	509	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam02397	Bac_transf	3.97e-71	62	241	1	180	Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.
COG2148	WcaJ	1.99e-61	61	239	40	218	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) [Cell wall/membrane/envelope biogenesis].
PRK10124	PRK10124	9.32e-38	61	242	272	458	putative UDP-glucose lipid carrier transferase; Provisional
PRK15204	PRK15204	1.10e-28	59	246	277	474	undecaprenyl-phosphate galactose phosphotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARD67681.1	1.53e-310	8	572	1	565
CCO04322.1	1.62e-152	32	418	1	373
BAK48513.1	5.36e-152	8	417	1	396
AOP02705.1	8.07e-121	309	573	3	272
AOP02632.1	8.07e-121	309	573	3	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W7L_A	1.28e-62	55	256	4	199	Structureof Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826],5W7L_B Structure of Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826]
2Z86_A	2.31e-07	323	421	388	488	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	2.31e-07	323	421	387	487	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
6P61_A	6.52e-06	311	403	16	108	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5HEA_A	7.93e-06	311	398	8	95	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9D0	1.49e-57	57	256	2	194	Undecaprenyl phosphate N,N'-diacetylbacillosamine 1-phosphate transferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglC PE=1 SV=1
P71062	3.76e-53	61	256	3	192	Uncharacterized sugar transferase EpsL OS=Bacillus subtilis (strain 168) OX=224308 GN=epsL PE=2 SV=1
Q48215	2.15e-43	309	573	2	267	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q03084	1.91e-42	309	573	7	273	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
Q46635	2.04e-41	310	569	2	262	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.968067	0.031609	0.000119	0.000076	0.000058	0.000068

TMHMM  Annotations     

start	end
13	32
66	88
538	560