CAZyme Information: MGYG000002314_03479

Basic Information

• Species: Brevibacillus_C massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Brevibacillales; Brevibacillaceae; Brevibacillus_C; Brevibacillus_C massiliensis
• CAZyme ID: MGYG000002314_03479
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		25451.73	5.3726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002314	4952787	Isolate	France	Europe

• Gene Location: Start: 82814; End: 83518 Strand: -

Full Sequence      

MGRVLVYNGMWNVLGQVGVNMNIDLRFVAAQNKYIQGNAFLNNTSALPLDQSFADLLDAQ
LAAGGRIISAEQVLAELDGRYEGKSTYPANHQDILAMIERTASRFGVDSGLVREVVRAES
NFNPSAVSRAGAKGLMQLMDATARSLQVRDAFDPQQNLSGGVRYLRDLLQRYDGNVKVAL
AAYNAGPGRVDRMGIATDSDFDRKAGELPAETRKYVAEIMDRLAIQAGQPGEQP

Enzyme Prediction     

No EC number prediction in MGYG000002314_03479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	111	223	1.5e-30	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	6.37e-41	111	224	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.06e-40	88	221	1	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.83e-39	87	220	2	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	4.93e-32	102	192	5	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	4.31e-30	119	222	22	155	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO39843.1	3.63e-67	53	223	35	218
QQE72765.1	3.63e-67	53	223	35	218
QRG69903.1	1.23e-64	21	223	1	226
QAV14279.1	1.13e-63	53	223	34	218
QHZ56913.1	1.13e-63	53	223	34	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.71e-15	100	227	422	556	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.71e-15	100	227	426	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.72e-15	100	227	432	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.73e-15	100	227	442	576	Lytictransglycosylase in action [Neisseria meningitidis]
5O24_A	1.73e-15	100	227	436	570	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.78e-33	98	194	64	160	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.13e-25	79	220	1416	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.13e-25	79	220	1416	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	1.36e-17	98	231	11	127	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	2.42e-15	97	202	289	401	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002314_03479.