CAZyme Information: MGYG000002315_00369

Basic Information

• Species: Anaerococcus vaginalis_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus vaginalis_B
• CAZyme ID: MGYG000002315_00369
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692	MGYG000002315_8|CGC1	79425.13	9.5465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002315	1997974	Isolate	France	Europe

• Gene Location: Start: 57522; End: 59600 Strand: -

Full Sequence      

MKNIVKILSLSTIIFISFSAKSYAYDEQVDENIINSNVESKINVEKNYTDLENDGETESK
SNNSNFDSEINSDSDNKDSNNKEYDSRENNSSNENDYSIKNKRTLYKFNNLSNKIDNYES
NFKFYKKDNNIYCVNANDNKPVDKGWIEHKGKKYFCKKDGQLYVNQIISFGPKVAYYMGS
DGSVVKSVFRDKEVLRYADYNTGILSHIGWIEENGKRYYSKNNLGELYTNQIISFGPKVA
YYMGSDGSIVKSVFKDKEVLRHADKYTGILSHSGWIEENGKRYYSKNNLGELYTNQIISF
GPKVAYYMGSDGTTSKSFFWDKGILRHADKYTGILSHSGWIEENGKRYYSKNNLGELYTN
QIISFGPKVAYYMGNDGATSKSFFWDRGILRHADKYTGILSHIGWIEENGKKYYSKNNFG
ELYRNQIISFGPKVKYYMGSDGSVGGLISGWFIKDGKTSYAFPNGTLAKGHVDIDGLKYY
FDNKGYLRSKVGIDISIWNKIINWNDIKKAGIEFVIIRSSGSYAANGKLYKDDNFISNIR
GAISAGLKVGVYHYSQAITKQEAINEARFVDSIIRPYKSKIKLPVTFDREIYSAGNGYLG
RTHNIGKDRDTEVSLAFLDEITRLGYKASFYSYTNYLNNRINMNKISKKYPVWVAQYHYK
CDYKGSYYMWQYTSKGKIKGIRGNIDLNIMYV

Enzyme Prediction     

No EC number prediction in MGYG000002315_00369.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	493	681	6.7e-44	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	6.63e-61	490	691	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
pfam01183	Glyco_hydro_25	4.80e-34	493	681	1	180	Glycosyl hydrolases family 25.
cd00599	GH25_muramidase	1.13e-30	492	690	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	1.11e-26	492	688	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06522	GH25_AtlA-like	5.90e-23	493	691	4	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK17162.1	3.51e-124	142	689	414	1035
AKT46655.1	4.15e-61	143	441	134	429
AVM48757.1	7.63e-45	474	691	4	214
ASS37354.1	4.01e-44	492	691	3	194
CBK74089.1	2.92e-43	434	689	264	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	6.02e-22	395	691	173	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.43e-21	395	691	173	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRU_A	2.47e-18	492	688	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.74e-17	492	688	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	5.03e-13	492	688	7	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	2.85e-15	492	688	11	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	4.42e-14	492	688	3	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P25310	8.45e-12	492	688	84	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P49331	7.10e-09	124	513	1076	1454	Glucosyltransferase-S OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfD PE=3 SV=3
Q8HA43	4.04e-06	482	690	146	341	D-alanyl-L-alanine endopeptidase OS=Streptococcus phage B30 OX=209152 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000818	0.998209	0.000404	0.000183	0.000180	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002315_00369.