CAZyme Information: MGYG000002317_01414

Basic Information

• Species: Peptoniphilus_A grossensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_A; Peptoniphilus_A grossensis
• CAZyme ID: MGYG000002317_01414
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		21914.04	9.229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002317	2029837	Isolate	France	Europe

• Gene Location: Start: 21871; End: 22440 Strand: +

Full Sequence      

MKIKKIGCGCLIIILSFLAIVFVMSFFINRAEKRRALEEENYRENYIEESAKLAVRVAKR
NDLFPSVMIAQSILESDWGRSELSREYNNYFGIKEVKKGDGIVFETEEYVEGQSGRYMES
FKKYSSKSESFNHYAKLLSTAKRYAKVKTAKDYREAAKYIQEGGYATDPNYANKIISVIE
KYGLNKYDE

Enzyme Prediction     

No EC number prediction in MGYG000002317_01414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	51	184	5.3e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	8.08e-56	44	189	44	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.77e-34	44	188	321	472	amidase domain-containing protein.
TIGR02541	flagell_FlgJ	2.58e-33	54	181	159	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK05684	flgJ	5.80e-32	51	181	163	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	3.75e-30	44	188	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ35583.1	1.08e-97	1	189	1	189
QQE46577.1	1.08e-97	1	189	1	189
QQT90265.1	3.09e-97	1	189	1	189
CDZ75698.1	2.71e-44	28	189	26	185
CBH20308.1	1.89e-37	32	188	47	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.05e-22	29	188	15	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.88e-20	46	189	63	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.10e-19	53	181	12	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.55e-19	53	181	12	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.38e-19	68	186	26	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.80e-30	32	189	37	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	8.56e-23	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	3.03e-22	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P37710	7.08e-22	31	188	168	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P0C2T5	7.88e-22	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.979125	0.003570	0.011752	0.000027	0.000018	0.005541

TMHMM  Annotations     

start	end
7	29