CAZyme Information: MGYG000002318_00439

Basic Information

• Species: Kallipyga massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Kallipyga; Kallipyga massiliensis
• CAZyme ID: MGYG000002318_00439
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216		25105.84	9.6025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002318	1751953	Isolate	France	Europe

• Gene Location: Start: 226922; End: 227572 Strand: -

Full Sequence      

MQKKTPKPHRPSARSTRRRRPDPLKRSRAPIYLLLVLVLAMAFFYYLVNWGPLAYRRHTV
SDLPYHDLFIPKAQEYGLSPYLVAGVIQQESAFKPMAESPVGARGLMQVMPDTGRYIARK
RGLDFDPDDLYQPETNIDYGCWYLSYLMKRFDGVIPTVLAAYNAGPNITQKWLEDPEYSK
DGRTLYRIPYGETDRYVVKVMGYMEDFREKSNTSDQ

Enzyme Prediction     

No EC number prediction in MGYG000002318_00439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	78	212	1.7e-33	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	8.04e-72	63	205	2	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.65e-55	63	204	4	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.07e-42	80	205	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	6.71e-37	69	173	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.00e-35	62	205	136	281	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT54455.1	2.23e-47	26	209	21	204
AYH39946.1	4.87e-46	63	209	47	192
AUM96786.1	3.90e-44	34	208	7	176
AVQ54237.1	3.90e-44	34	208	7	176
AUN22945.1	5.52e-44	34	208	7	176

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.00e-21	64	201	415	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.02e-21	64	201	419	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.04e-21	64	201	425	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.05e-21	64	201	429	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.06e-21	64	201	435	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	5.90e-20	63	208	478	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	3.15e-18	63	208	478	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.15e-18	63	208	478	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31608	7.66e-17	54	200	44	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.01e-16	73	201	1430	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999981	0.000043	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
29	51