CAZyme Information: MGYG000002319_00372

Basic Information

• Species: Limosilactobacillus mucosae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus mucosae
• CAZyme ID: MGYG000002319_00372
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase-stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MGYG000002319_7|CGC1	51709.61	5.6494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002319	2369669	Isolate	not provided	not provided

• Gene Location: Start: 47496; End: 48839 Strand: +

Full Sequence      

MLNLFDDWQRGSIDLVRSQKIAGIKVPTVVINDDGFLPAEVDSPIKQYRKQTGEPLYFDQ
VQVPRFWQIKGDASGAQVYDLNTKRAEIRFFKNDNTRFVKQVEWLNATGELQWIDQYDQH
GQRFAKTFYAKGQAKLKQYYDAAQNVVIDHHLTTDDIFLYIGGRQRHFANWLELTANFLQ
KSDYQLDHIIYNTLNQAFFTTLKLPNKNASDVLVWQEGLGNELPGNMRFIFENQTRTKQI
WMQNHQAWVQYQEKFAKSADDETQPSDVKVQQLGTIYPHPRGNQMRPAILIMTNSDQIEM
LSVLAARLKNFDFHVAALTEMSEKLLQIGEQANVHLYPAVSFAKAKQLMADCDIYLDINR
GDQIIDAVRAAFENNQLILGFNDTLHLPELVAPDNRYDETQLDAMIEKILLAMVKPAVME
QLIDSQREFAGDAKVETYQKRFNELRS

Enzyme Prediction     

No EC number prediction in MGYG000002319_00372.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02919	TIGR02919	9.49e-155	1	440	1	436	accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJT50305.1	0.0	1	447	1	447
QLI94761.1	1.05e-156	1	439	1	433
QOL69838.1	2.10e-156	1	439	1	433
AJT50057.1	4.86e-155	1	439	1	433
QDR72365.1	4.05e-149	1	446	1	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9U_B	2.08e-83	2	445	2	444	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
5E9T_B	2.14e-83	2	445	2	444	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_D Crystal structure of GtfA/B complex [Streptococcus gordonii]
5GVW_A	6.12e-07	292	384	283	375	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0S4NND9	4.60e-146	1	447	1	440	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtfB PE=3 SV=1
Q79T00	3.05e-87	1	445	1	444	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus gordonii OX=1302 GN=gtfB PE=1 SV=1
A0A0H2UR90	2.08e-86	1	440	1	437	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfB PE=1 SV=1
Q3S2Y1	9.67e-80	1	440	1	434	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus agalactiae OX=1311 GN=gtfB PE=1 SV=1
A1C3M0	1.77e-79	1	388	1	384	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus parasanguinis OX=1318 GN=gtfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002319_00372.