CAZyme Information: MGYG000002319_01818

Basic Information

• Species: Limosilactobacillus mucosae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus mucosae
• CAZyme ID: MGYG000002319_01818
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000002319_12|CGC1	53758.07	9.0587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002319	2369669	Isolate	not provided	not provided

• Gene Location: Start: 49052; End: 50428 Strand: -

Full Sequence      

MRKIISITMVNNESEIIESFIRYNYNFLDEMVIIDNGCTDNTIKIVNKLISEGFNITVYD
ESLSAYDQFRIDNKYLNLIIDEKNPDIVIPLDADEFIASDNQNPRKILESLDLNKVYYVN
WRWYVLTDKDNLNEPFIPKRLEYCLTKPAWNFSDNKPVTKVILPTNYYKKKKLKLTMGHH
KVFGANEVLTESLNQLFFAHYRAISEDQIIYKTECYTIRDITTMGNNVETAQRTNQMYMI
ENGNDMWEVAKEVSYGGYNCPIVHNPINLNFCKKKNIEIKYGNLNDTISERLLNTGREVA
IRAYNSERKHKEKKFVKPIILVLDGVRGEECLFPNPSNKLTVLTEMFNVRGTWTDRDEIS
FLKVNYRLIVNSKFLKFLPHQYVVVPDTLDFNKTKRTLINNGIEEAQIISLKDYLKKLGF
FKLSYCCLRFVPSMTERVIKYVKRNGLSNTIKKLRNRL

Enzyme Prediction     

No EC number prediction in MGYG000002319_01818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	11	102	2e-16	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13704	Glyco_tranf_2_4	4.64e-12	12	101	2	88	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
cd02525	Succinoglycan_BP_ExoA	2.26e-05	5	100	2	97	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd00761	Glyco_tranf_GTA_type	2.83e-05	7	94	3	87	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02511	Beta4Glucosyltransferase	6.22e-05	5	126	2	113	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	0.003	15	100	15	94	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APZ79517.1	6.03e-217	3	458	27	481
AUW24982.1	7.02e-217	3	458	2	456
ABD74474.1	7.02e-217	3	458	2	456
ARL70956.1	7.02e-217	3	458	2	456
ABD74475.1	7.02e-217	3	458	2	456

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002319_01818.