CAZyme Information: MGYG000002319_01962

Basic Information

• Species: Limosilactobacillus mucosae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus mucosae
• CAZyme ID: MGYG000002319_01962
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737	MGYG000002319_12|CGC4	84667.44	4.8545

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002319	2369669	Isolate	not provided	not provided

• Gene Location: Start: 213846; End: 216059 Strand: -

Full Sequence      

MSIQVNASNRLFHLQTKHTSYVFHVIEDGSLGQLYYGPKIPFKDDYANLNTREEHDCTNT
RTDEDVEFQAELLKQEYAGLGKGDYRYPAFQITYPNGSRTSEFQYRDYELKDGKARLTGL
PSTFADDSNDSQTLTVKLADGDLELQLHYTIFADEDVIVRSTTFVNHGKTVFLNRALSAQ
LDLPDANYDFIQFAGSWSRERHLHRSHLRPGTQSISSLRTASSHQENPFFMLARPHTDNN
QGAVFGFNFVYSGNFLDSVEVDQFDTTRVLIGINPDEFGWKLNSGDSFQTPEVIFSYTDN
GFNALSQQLGAFYAQHLINPHFAHQERPILINNWEATFMDFTEDKLMPIVERAKELGIEM
FVLDDGWFGHRDDDRSSLGDWFVDEKKFNHGIAGFAKRVHDLDMKFGLWFEPEMISIDSK
LYQTHPEWMIKTPGRGQTPGRHQFVLDMSRQEVVDYLFGLMSHIIQDAKLDYIKWDMNRN
ITEMYGADLPADQQLEFSHRYILGVYDLYDRLTKAFPDVLFESCASGGGRFDLGMMYYAP
QAWCSDDTDAVERIKIQDGTSYGYTPSMWGAHVSAVPNDQVGRLTSIDMRAKVAYFGAFG
YELDVTELSDEEQATIKQQVAFYKQYRKLFQFGTFYRLETPDTSDNVYGWETVSHDKQTA
IGMRYQILNGANPAYIRYYFKGLDPERRYTVNDGSEVFSGAELMNAGYFVPRVMNRLQSP
KVPSDFHADMFIVKAVD

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	708	2.1e-276	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	9	707	1	664	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	0.0	287	633	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	5.86e-145	326	625	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	2.68e-108	29	283	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	6.41e-20	650	719	4	73	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJT49688.1	0.0	1	737	1	737
QOL70215.1	0.0	1	737	1	737
QLI95193.1	0.0	1	737	1	737
QFG72053.1	0.0	1	734	1	737
QLL70891.1	0.0	1	736	1	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3MI6_A	0.0	2	736	2	737	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
4FNQ_A	3.11e-233	1	711	1	711	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.86e-231	1	736	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	2.63e-229	1	736	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	3.73e-229	1	736	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.57e-230	1	736	1	727	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
P43467	2.34e-220	3	713	4	716	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
G1UB44	1.29e-219	3	737	6	732	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
G4T4R7	1.70e-195	1	711	1	704	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	1.55e-172	9	707	7	700	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002319_01962.