CAZyme Information: MGYG000002320_00186

Basic Information

• Species: Enterococcus_B lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B lactis
• CAZyme ID: MGYG000002320_00186
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		39567.03	7.2467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002320	3009500	Isolate	Ireland	Europe

• Gene Location: Start: 96986; End: 98083 Strand: -

Full Sequence      

MADNVYKYLVDIANQAVRKFGMSGITSGYRPGDPYWHGKHQAIDIAYPSSMNGSSKYFDP
ANWVFENFADKVGYVITQGKVRDRTGQSGQPTTGSWEPWPDNDHYDHLHITGKLGSGDIF
KAGGGSSPAGSGAERWRSQVIEAAKMVGFPTDKGHIDRIISQIQTESGGNEKAVQGGYTD
INTITGDLAKGLMQTISATFNAYKMPGHGNIFNGYDNILAGLRYIMAQYGTGAGFFANIG
MGHGYADGGEINGPELAWIGEDPAYPKEFMINPAKSSADDLIIKAIRSREQFRPTSANNV
SSNSSGFLTSEISESSLQKLSQALNNRPVEVISHLDGKKVSKSVDEYTGSSLARKLYMRG
KNFNG

Enzyme Prediction     

No EC number prediction in MGYG000002320_00186.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13402	LT_TF-like	6.43e-44	156	275	1	116	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG3953	SLT	7.42e-34	154	347	13	222	SLT domain protein [Mobilome: prophages, transposons].
pfam01464	SLT	1.92e-06	163	231	19	83	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	8.17e-05	163	230	8	68	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00442	Lyz-like	0.003	156	224	2	59	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGE29988.1	1.64e-253	1	365	1179	1543
AGE30652.1	1.64e-253	1	365	1179	1543
QPQ26075.1	6.78e-253	1	365	1208	1572
QPL61215.1	5.44e-157	1	365	1127	1496
QAA19693.1	1.86e-150	1	361	1127	1492

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45931	8.08e-14	116	261	1329	1472	Uncharacterized protein YqbO OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbO PE=1 SV=2
P54334	1.86e-13	116	261	1077	1220	Phage-like element PBSX protein XkdO OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdO PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002320_00186.