CAZyme Information: MGYG000002320_02858

Basic Information

• Species: Enterococcus_B lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B lactis
• CAZyme ID: MGYG000002320_02858
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000002320_20|CGC1	34537.86	6.4887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002320	3009500	Isolate	Ireland	Europe

• Gene Location: Start: 7033; End: 7956 Strand: -

Full Sequence      

MRMKDKLIIGKNSIDTPTDFETIQEGIDYLADLPDSHPKVLIVKEGRYDEYIESRLSNFK
LVGTGTVVISGNRFAKQEYLDGSQLGTFRSATFFLEGSNVVLENLHIENTAGPGEKVGQA
VALFNSGDRVLLKNCRLTGYQDTLCTGPLPDLQKDGTPFCTPASVNPDYCRQTYEYCWIE
GTVDFIFGGADAIFRQCRIHSLASKNPGYITAASTPKNQKSGYRFESCTLTAEPDTRNVY
LGRPWRPYANVVFEACKIGGHVHPTGWDNWDDKKNEQTAKFSERNNNYETPIKRPEWIHL
EKQGVLK

Enzyme Prediction     

No EC number prediction in MGYG000002320_02858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	16	299	1.2e-76	0.9097222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	2.87e-55	19	271	11	246	Pectinesterase.
COG4677	PemB	6.50e-55	19	297	93	384	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	6.65e-50	15	283	12	262	pectinesterase
PLN02745	PLN02745	9.52e-42	15	286	292	546	Putative pectinesterase/pectinesterase inhibitor
PLN03043	PLN03043	5.39e-41	3	286	221	487	Probable pectinesterase/pectinesterase inhibitor; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA35303.1	3.06e-237	1	307	1	307
AWX48560.1	2.51e-236	1	307	1	307
QZY26075.1	2.51e-236	1	307	1	307
QJS43752.1	1.45e-235	1	307	1	307
QEN53172.1	1.45e-235	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.28e-35	19	287	14	265	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	6.13e-26	20	292	19	277	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.15e-25	20	292	19	277	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	8.19e-24	9	286	5	268	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	3.88e-22	8	282	7	295	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.88e-36	13	283	10	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FF77	4.26e-34	3	286	304	570	Probable pectinesterase/pectinesterase inhibitor 47 OS=Arabidopsis thaliana OX=3702 GN=PME47 PE=2 SV=1
Q43043	3.30e-33	13	271	62	303	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
O48711	4.31e-33	20	297	248	510	Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana OX=3702 GN=PME12 PE=2 SV=1
P09607	4.42e-33	9	287	234	498	Pectinesterase 2.1 OS=Solanum lycopersicum OX=4081 GN=PME2.1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002320_02858.