CAZyme Information: MGYG000002322_01416

Basic Information

• Species: Escherichia marmotae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia marmotae
• CAZyme ID: MGYG000002322_01416
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000002322_23|CGC2	36764.64	8.2807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002322	4486744	Isolate	not provided	not provided

• Gene Location: Start: 125818; End: 126804 Strand: -

Full Sequence      

MKKLSAIPLVISLLFINYSSLTLAAESLPDASSLGLENLTNDLSRQELFVKILESDPSRD
KEFDSFAVKKYFKFPADVAYDSVLNQPRPSSLFGVDISHHNGRNFPIELLAKNKSVFLYM
KSSQGTRYVDPEFAGFWQRAGDTERGIKLHRGAYHFLSSGTPADDAELWGRKQAMTFVKV
IKANGGLRATDMPPAVDVEWDVDSLTGKDRWQKRKPAEIITMIKAFTAQVEADLGRKPVI
YTARAWWKDAVGGENSFAQVAEHKLWLADYSNQAQASETPRSINQTKWAIWQFTDAAQLN
LGSSKKFDASIYKGPTAEFYSTLGVQEF

Enzyme Prediction     

No EC number prediction in MGYG000002322_01416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	95	300	8.6e-37	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	3.87e-46	93	314	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd00599	GH25_muramidase	1.47e-33	94	312	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	6.06e-29	94	295	5	173	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06412	GH25_CH-type	2.91e-27	94	311	3	196	CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans. CH-type lysozymes exhibit both lysozyme (acetylmuramidase) and diacetylmuramidase activity. The first member of this family to be described was a muramidase from the fungus Chalaropsis. However, a majority of the CH-type lysozymes are found in bacteriophages and Gram-positive bacteria such as Streptomyces and Clostridium. CH-type lysozymes have a single glycosyl hydrolase family 25 (GH25) domain with an unusual beta/alpha-barrel fold in which the last strand of the barrel is antiparallel to strands beta7 and beta1. Most CH-type lysozymes appear to lack the cell wall-binding domain found in other GH25 muramidases.
pfam01183	Glyco_hydro_25	2.41e-26	95	300	1	178	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLP29774.1	5.12e-242	1	328	1	328
AUT26623.1	5.12e-242	1	328	1	328
QLP27222.1	5.12e-242	1	328	1	328
VED78783.1	5.12e-242	1	328	1	328
QLX30379.1	5.12e-242	1	328	1	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	6.01e-12	94	319	18	213	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999074	0.000181	0.000158	0.000150	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002322_01416.