CAZyme Information: MGYG000002322_01717

Basic Information

• Species: Escherichia marmotae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia marmotae
• CAZyme ID: MGYG000002322_01717
• CAZy Family: GT4
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002322_23|CGC7	41893.79	9.5919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002322	4486744	Isolate	not provided	not provided

• Gene Location: Start: 428379; End: 429476 Strand: -

Full Sequence      

MRITQVIPTLSTGGAEQFVISLSNELSKKNDVTLITLFKIKDNIIRKRLSDKVTLIELNG
EINNKISILFKLNAVLLKTKHDVIHTHLSIPFYILPFAFFCKDKYRVIHTIHNIARYDAP
RKLAKYINKAYFKICKAIPVSISDIVSESVKNYYNLRYTEIIKNGTETISETVKYEGVKR
RVKELRKQYTNVFCHIARMDPQKNHRLLIDVLKKNKECYVISMGAITQDNIKYAKHIMDY
SKKISNFEYIGVVDNVSDFIKSSDGIIFSSVYEGLPISLIEGMSVGKICISTPAGGIADI
LDDECGVLANDFSEAQLDIAIKKFMSFSECKKRHMEYNIRNRFKNEFSISICAEKYSQIY
ENNKS

Enzyme Prediction     

No EC number prediction in MGYG000002322_01717.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	185	333	9.8e-22	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	2.51e-37	2	327	1	328	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	1.02e-35	13	361	14	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03807	GT4_WbnK-like	1.23e-35	2	361	1	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03808	GT4_CapM-like	7.75e-32	9	357	6	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
COG0438	RfaB	1.70e-27	1	361	3	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLP29252.1	2.52e-263	1	365	1	365
AXY99522.1	1.20e-73	2	363	9	375
QEC67379.1	9.54e-61	2	362	3	368
AQX08206.1	3.79e-59	1	360	16	376
QKJ22281.1	5.19e-59	1	360	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJJ_A	1.24e-09	1	359	3	353	Structureof a glycosyltransferase / state 2 [Campylobacter jejuni],6EJJ_B Structure of a glycosyltransferase / state 2 [Campylobacter jejuni]
6EJI_A	1.24e-08	2	359	4	353	Structureof a glycosyltransferase [Campylobacter jejuni],6EJI_B Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_A Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_B Structure of a glycosyltransferase [Campylobacter jejuni]
6KUW_A	8.12e-06	193	353	248	424	Crystalstructure of human alpha2C adrenergic G protein-coupled receptor. [Homo sapiens],6KUW_B Crystal structure of human alpha2C adrenergic G protein-coupled receptor. [Homo sapiens]
3L01_A	9.89e-06	193	360	254	427	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C5	3.55e-10	1	365	2	358	GalNAc-alpha-(1->4)-GalNAc-alpha-(1->3)-diNAcBac-PP-undecaprenol alpha-1,4-N-acetyl-D-galactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglH PE=1 SV=1
P39857	4.66e-10	65	360	63	350	Capsular polysaccharide biosynthesis glycosyltransferase CapH OS=Staphylococcus aureus OX=1280 GN=capH PE=3 SV=1
Q58459	1.72e-06	162	313	167	342	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998702	0.001218	0.000060	0.000005	0.000002	0.000031

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002322_01717.