CAZyme Information: MGYG000002323_02824

Basic Information

• Species: Escherichia sp000208585
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia sp000208585
• CAZyme ID: MGYG000002323_02824
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000002323_16|CGC2	62405.4	9.089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002323	4514939	Isolate	not provided	not provided

• Gene Location: Start: 208016; End: 209668 Strand: +

Full Sequence      

MKSVRYLIGLFAFIVCYYVLPISTRLLWQPDETRYAEISREMLASGDWIVPHLLGLRYFE
KPIAGYWINSIGQWLFGANNIGVRAGVIFATLLTAALVAWFTLRLWRDKRLALLAAVVYL
SLFIVYAIGTYAVLDPFIAFWLVAGMCSFWLAMQAQTRRGKSAGFLLLGLTCGMGVMTKG
FLALAVPVLSVLPWVATQKRWKDFFIYGWLAVISCVLTVLPWGLAIAQREPDFWHYFFWV
EHIQRFAMDDAQHKAPIWYYLPVIIAGSLPWLGLLPGALYAGWKNRNHSATVYLLSWMVM
PLLFFSVAKGKLPTYILSCFAPLAMLMAHYALQSAKNNPLALRINGWVNIAFGVTGIIAT
FVVSPWGPMNTPVWQTFEIYKVFCSWSIFSLWAFFGWYTLTNVDKTWPFAALCPLGMALL
VGFSIPDRVMEGKHPQFFVEMTQESLQPSRYILTDSVGVAAGLAWSLQRDDIIMYRQTGE
LKYGLNYTDAQGRFVSGDNFSKWLNQHRQEGIITLVLSVDHDEDINSLAIPPADAIDHQG
RLVLIQYRPK

Enzyme Prediction     

No EC number prediction in MGYG000002323_02824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	522	5.8e-156	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	549	2	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	6.11e-113	1	523	6	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	9.35e-52	3	237	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	7.46e-10	61	222	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVF99909.1	0.0	1	550	1	550
QED73184.1	0.0	1	550	1	550
CAS09949.1	0.0	1	550	1	550
SLM07350.1	0.0	1	550	1	550
SNU20835.1	0.0	1	550	1	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.95e-30	22	386	49	412	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7UFR9	0.0	1	550	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1
Q0TFI5	0.0	1	550	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=arnT PE=3 SV=1
Q0T2M6	0.0	1	550	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=arnT PE=3 SV=2
P76473	0.0	1	550	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain K12) OX=83333 GN=arnT PE=1 SV=1
Q1R9F8	0.0	1	550	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000004	0.000021	0.000005	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
7	29
81	103
110	132
137	154
167	189
204	226
257	279
289	308
315	332
347	369
382	401
406	425