CAZyme Information: MGYG000002325_01125

Basic Information

• Species: Listeria monocytogenes_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes_B
• CAZyme ID: MGYG000002325_01125
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000002325_1|CGC23	29631.45	8.5722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002325	3017944	Isolate	Canada	North America

• Gene Location: Start: 1133951; End: 1134733 Strand: +

Full Sequence      

MIKKVFHFILVLMLSVSIMPLFHAKAAETTNGVDSSEQEDNTEVAREEMPPESEEPVFSL
EQNRDDAMAALVVPQTRNSFLRAASTPTFQQTFINSISAQAMDLCKKYNLYPSVMIAQAA
LESNWGRSELGKAPNYNLFGIKGSYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESL
EDNAKKLRNGPSWDSSYYKGAWRENAKTYKDATAWLQGRYATDNTYASKLNTLISSYNLT
QYDTLYDTIKQQKMFLKMLK

Enzyme Prediction     

No EC number prediction in MGYG000002325_01125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	100	239	3.2e-31	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.33e-67	90	249	43	194	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	3.65e-62	63	244	123	304	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	1.74e-58	92	243	322	472	amidase domain-containing protein.
smart00047	LYZ2	7.97e-34	91	243	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	4.84e-25	101	189	4	84	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY48666.1	1.38e-176	1	253	1	253
QOF65656.1	1.38e-176	1	253	1	253
APO61250.1	1.38e-176	1	253	1	253
AMD27034.1	1.38e-176	1	253	1	253
AMD24113.1	1.38e-176	1	253	1	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.32e-127	52	243	4	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	5.28e-40	93	243	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	4.25e-15	91	241	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.14e-15	91	241	3	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.64e-14	91	241	3	151	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	6.10e-47	82	244	164	334	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	2.52e-45	71	243	46	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	2.65e-44	71	243	46	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	2.75e-44	71	243	46	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	3.75e-42	93	244	65	215	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005229	0.991252	0.002775	0.000288	0.000234	0.000218

TMHMM  Annotations     

start	end
5	24