CAZyme Information: MGYG000002326_00757

Basic Information

• Species: Alkalihalobacillus alcalophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_H; Bacillaceae_D; Alkalihalobacillus; Alkalihalobacillus alcalophilus
• CAZyme ID: MGYG000002326_00757
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207		23643.37	10.1491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002326	4217920	Isolate	not provided	not provided

• Gene Location: Start: 35038; End: 35661 Strand: +

Full Sequence      

MIAPDGKRLQLPVNPSLVQINRMKKFETISIMNLGEVDFTDGGKYINEIHFSSFFPSFYD
GSYCKYANIPKPQDAMQQVTKWMDSKEPIRLIITETPINMLVNLAFHNSEYKGGEPGDIY
FDLSCRTYRTVKVKSKQVTVKKVTTRPDTKPKPKNYTVKSGDSLWKIAAMKQHYGAGSRW
PEIYNRNKSVVGKNPNLIYPGQKLVIP

Enzyme Prediction     

No EC number prediction in MGYG000002326_00757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	156	207	5.1e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	4.00e-18	147	207	89	146	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	4.95e-18	2	207	71	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
NF033163	lipo_LipL71	3.29e-15	154	207	405	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
cd00118	LysM	8.50e-11	156	206	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	2.31e-08	156	207	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA42419.1	2.97e-138	18	207	1	190
AJA42475.1	3.96e-135	23	207	1	185
AZS15369.1	1.97e-65	1	207	5	215
BBI31456.1	1.17e-64	12	207	16	206
AEG61700.1	3.02e-64	4	207	8	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	1.54e-33	2	207	10	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	1.05e-30	2	207	10	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002326_00757.