CAZyme Information: MGYG000002326_02295

Basic Information

• Species: Alkalihalobacillus alcalophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_H; Bacillaceae_D; Alkalihalobacillus; Alkalihalobacillus alcalophilus
• CAZyme ID: MGYG000002326_02295
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		56021.68	5.5624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002326	4217920	Isolate	not provided	not provided

• Gene Location: Start: 5346; End: 6812 Strand: -

Full Sequence      

MNIVFAASECYPFFKTGGLADVIGSLPSQLQDEHTRVSVILPKAAILQAEFEEQLTFVTS
FPVYVKWRKQYCGVFTLQQQSITYYFIDNEYYFKRERLYGYPDDGERFVFFTHAILALLE
ELHLEVDLLHCHDWQTALLPAYLKAKQSDIQTVFTIHNLHYQGVFPKNIFYELLHFSDEH
LPGLLHEDCINFVKAAIFHADFITTVSPSYAEEITTELGGEGLHQILSQNKNKLCGILNG
VDTNSYDPLLDPNISVPFYQDPDRKSENKLTLQDELHLPSSKDIPVFTVISRLVQSKGPD
LLLDVADELLQNENVQLIIVGTGEERLEQNFLQLQSRYPSKVRTVLGFSESFARKVYASA
DFLLMPSLFEPCGLSQMVALQYETVPIVRETGGLKDTISAFNEYEGAGNGLSFTNYNASD
FLYTIRRGLYLYKNKELWSQLLSNIYKSTFNWEQSALMYKKLYLSLRDRRGVSTNEHHPN
RVCSKLHR

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	463	5.5e-164	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	1	466	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	469	1	466	glycogen synthase GlgA.
COG0297	GlgA	0.0	1	470	1	482	Glycogen synthase [Carbohydrate transport and metabolism].
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	465	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	1.29e-96	1	470	4	483	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARK29123.1	9.00e-185	1	466	1	468
ADC50286.1	1.33e-184	1	463	1	465
QKS72105.1	2.11e-166	2	466	3	469
CAV22750.1	2.10e-165	1	472	1	474
BAB04804.1	2.10e-165	1	472	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.17e-82	1	467	1	477	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	2.04e-82	1	467	1	477	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.58e-81	1	467	1	477	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.88e-73	1	482	10	508	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
1RZU_A	3.59e-70	1	466	1	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KDX6	4.20e-166	1	472	1	474	Glycogen synthase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=glgA PE=3 SV=1
Q8ET54	9.49e-150	2	466	3	469	Glycogen synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=glgA PE=3 SV=1
A4J4I4	2.98e-149	1	466	1	474	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
B9J2G5	5.23e-149	1	468	1	476	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1
Q81K85	4.22e-148	1	468	1	476	Glycogen synthase OS=Bacillus anthracis OX=1392 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002326_02295.