CAZyme Information: MGYG000002326_03112

Basic Information

• Species: Alkalihalobacillus alcalophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_H; Bacillaceae_D; Alkalihalobacillus; Alkalihalobacillus alcalophilus
• CAZyme ID: MGYG000002326_03112
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000002326_192|CGC1	88377.35	6.0244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002326	4217920	Isolate	not provided	not provided

• Gene Location: Start: 9229; End: 11514 Strand: +

Full Sequence      

MVQVQLLDGIFKESADKGMDYLLFLDIDRLVAPFYEAASLAPKKQRYGGWEETGISGHSL
GHWLSAAAYMYRNTMNRALKDKINKAIDELEYIQSVHDRNFIGGFPSTCFEKVFTGNFEV
DHFTLAGHWVPWYSMHKLFAGLIDVYKLVKNEKALSVVTKLADWVESGTVRLTEAQFQKM
LICEHGGMNDVMAELYLLTQNQTYLQLAIRFCEQQILEPLSNRRDLLEGKHANTQIPKVI
GAAKLYDITKEEKYKTAATFFWQEVTRVRSYIIGGNSINEHFGRVSDETLGVQTTETCNT
YNMLKLTAHLFLWEQKSEYYDFYERALYNHILASQDPDSGMKAYFVSTEPGHFKVYHSPE
DSFWCCTGTGMENPTRYSEHIYYQRDDELFVNLFIASQLQLEEKELRLKLETDFPHSGRV
QLKVEEGDGRFLSIHLRIPYWINGKVSIFVNKKQTFLTDKKGYVTLSRRWKAGDRVEVDF
PLGLHSYIAKDDPNKVGFMYGPIVLAGALGRENFPETDIQANHLSLNAHPLIDVPVFIAD
KDRPWNWIKRVDGLPIQFETEPVGQPGNQRVTLIPFYQLHHERYSLYWSVMDENSFKALK
SLEKEKETRLKQITIDVVQPNEQQEEIEHFIQKKNSRSGYLNTVRRGWRDCRDDGFFSYK
MKVEPEKQMYLSIDFFNGDREIFIDGSQYIRHFTIAIDEVPIAEKRLEADGYEHELVQDI
YEIPYYLTEDKQIVEVKFSSSYGKVAGGVYGIKMLRENLND

Enzyme Prediction     

No EC number prediction in MGYG000002326_03112.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	3	506	4e-192	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	4	577	12	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	0.0	3	506	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
pfam16375	DUF4986	4.39e-13	529	588	24	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF29693.1	0.0	1	757	1	756
APH66456.1	0.0	1	759	1	758
SQI62179.1	0.0	1	757	1	756
QNK90233.1	0.0	5	759	6	759
QAV10929.1	0.0	1	757	1	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.73e-147	4	696	33	757	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.82e-143	4	696	33	757	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	7.88e-29	133	581	143	613	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	8.98e-25	63	504	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	8.53e-24	63	504	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.67e-09	63	504	81	564	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002326_03112.