CAZyme Information: MGYG000002326_03166

Basic Information

• Species: Alkalihalobacillus alcalophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_H; Bacillaceae_D; Alkalihalobacillus; Alkalihalobacillus alcalophilus
• CAZyme ID: MGYG000002326_03166
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000002326_196|CGC1	95613.47	5.5037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002326	4217920	Isolate	not provided	not provided

• Gene Location: Start: 9728; End: 12181 Strand: -

Full Sequence      

MKRINLNGAWKMRSTDTDEWIGVTVPGSVFNDLLQNKKIEDPFYRDNEKYAYEIASKDYQ
YSRKVKVEQDFLEQERIFLLCEGLDTLAEITINDHVIARTNNMHRTYEIDVKNILHLGEN
TITITLLSPVHYIKKLDEERPLWGVVDAIKGYPHIRKAHYMFGWDWGPKIPDSGIWRDIS
FVSYNEARLEDIYFTQVHHENLVELKTRIRLEKWLKGEVDVKVELTCPKGKTQMLSMTTD
QLEENIIFDIEEPELWWPNGYGKQPLYGLSVTVQSNGQALDVQTFEIGLRTIKVRQEPDQ
WGKTFEFEVNGLSIFSMGANYIPEDNLISRGSREKTERLIQDCIEANFNMIRVWGGGYYP
NKDFYELCDRYGLIVWQDFMFACGVYELTNEFTENIKKEIADNIKRLRHHASLALWCGNN
EMEEAWVHWDFPKTAKLRTDYLKQFEIIFPEIVKELDPETFYWVSSPSSGGGFDKPNSEN
EGDVHYWDVWHGLKPFTEYRKFHFRFCSEFGFQSFPSIKTIDSFTLPEDRNIFSNVMENH
QKNGEANGKILNYLSQTFLYPKDFKSLLYTSQILQAEAIKYGVEHWRRNRGRCMGSIYWQ
LNDCWPVASWSSIDNFGRWKALHYFAKKFYAPVLLSLCEEGTNVEIHLTNDKAVDVTCQV
DWKLRTNSTEVIKEGTVHSTVEKLSAKKLESLSFNELTDEKKRDVYVECTLFINGQQETM
VTVLFVKPKHFTFLDPKLKTEVLEENDQFIISVHSQAFAKYVELDLLDADCKFSDNYFDV
SANEKRVITVKKNSLSSKINLSEFKKQLSLRSVFDIS

Enzyme Prediction     

No EC number prediction in MGYG000002326_03166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	734	4e-114	0.7287234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.73e-113	1	648	10	647	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.69e-21	735	815	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	4.04e-19	5	421	43	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	1.71e-13	642	730	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	5.59e-11	187	290	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF27003.1	0.0	1	817	1	820
QUH28340.1	0.0	1	817	1	819
AUG59052.1	0.0	4	815	3	816
AWB45455.1	0.0	1	817	1	818
ADU28568.1	0.0	1	815	1	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	4.50e-167	1	811	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	4.63e-167	1	811	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	3.32e-166	1	811	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	3.42e-166	1	811	3	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.78e-164	6	790	11	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	2.14e-121	4	787	23	853	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	4.20e-121	4	787	23	853	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q5B7W2	8.36e-117	6	640	9	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
O00462	3.80e-116	5	788	24	854	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
A1D911	1.35e-114	1	791	4	829	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002326_03166.