CAZyme Information: MGYG000002328_01530

Basic Information

• Species: Enterocloster asparagiformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster asparagiformis
• CAZyme ID: MGYG000002328_01530
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146	MGYG000002328_88|CGC1	16621.62	4.3844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002328	6168028	Isolate	not provided	not provided

• Gene Location: Start: 4424; End: 4864 Strand: -

Full Sequence      

MSYRIEKNAAYMDVFRKVTDYFLAHLPSDLIPYWDFDFDDGSGEPRDSSSAAIAACGMLE
MAKFMEAEEAAYYRDMAGRLVKALSARCAVRRPDESNGLLLHGTYARASAGNPCADRGVD
ECNTWGDYFYMEALTRLVTDWEPYWY

Enzyme Prediction     

No EC number prediction in MGYG000002328_01530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	1	137	7.4e-42	0.3981762917933131

CDD Domains     

MGYG000002328_01530 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP42368.1	1.96e-87	1	146	247	392
ASN98783.1	1.96e-87	1	146	247	392
QJU23511.1	3.94e-87	1	146	247	392
SEU07984.1	2.48e-69	1	146	247	392
ABX41318.1	3.47e-66	1	145	247	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	2.90e-30	1	145	257	397	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANI_A	2.94e-30	1	145	258	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3ANJ_A	2.94e-30	1	145	258	398	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3VXD_A	2.94e-30	1	145	258	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	5.71e-30	1	145	258	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8E372	1.61e-29	1	145	258	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	5.91e-29	1	145	256	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	1.19e-28	1	145	259	399	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	4.47e-20	8	146	239	373	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
T2KLZ3	2.30e-14	1	136	264	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002328_01530.