CAZyme Information: MGYG000002329_00945

Basic Information

• Species: Dielma sp001305055
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Dielma; Dielma sp001305055
• CAZyme ID: MGYG000002329_00945
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000002329_8|CGC3	53914.04	4.8726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002329	3357599	Isolate	not provided	not provided

• Gene Location: Start: 180835; End: 182250 Strand: +

Full Sequence      

MSQLPKHFLWGGAVAANQLEGAWNVDGKGVSTADCMSAGAVDKAREYTDGVLEGVYYPNH
EGIDFYHHYKEDIALFAEMGFKCFRTSIAWTRIFPEGDEEVPNELGLQFYDDLFDECLKY
GFEPVVTISHYETPYALVKKYGSWRNRKLVDFFVKYAETVFKRYKYKVKYWMTFNEINCI
ALHPEIPSGIRVQEDESFAQVVYQAAHHEFVASAKAVKVGHEINPDFKIGMMMIYPWTYA
DTCKPEDTIKQMQAMDAQYYFSDVQVRGYYTNKAKKMLKEKGVILQAEAGDDQILREGIV
DYIGFSYYMSNVASSDPNKQVVDGNMLTGIRNPYLKATDWGWQIDPVGLRISLNQLYDRY
QIPVFIVENGMGAVDMVENDGSINDDYRIDYLRSHIEQLIKAVDEDGVELMGYTPWGCID
LISAGTGEMKKRYGFIYVDRDNEGNGTLARSKKKSFDWYKKVIATNGEDLA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	467	4.2e-146	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	470	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	471	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	470	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	469	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	470	6	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT41214.1	7.87e-259	6	470	7	472
BCJ98639.1	1.17e-254	1	470	1	470
AJQ29705.1	3.00e-254	3	470	5	473
CCP27273.1	9.51e-250	1	470	1	470
AEE92378.1	9.51e-250	1	470	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.50e-219	1	470	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.28e-219	1	470	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	9.72e-211	2	470	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
6WGD_A	3.77e-210	3	470	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	2.06e-207	4	470	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	8.37e-209	3	470	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.96e-207	1	470	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.13e-206	4	470	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	3.72e-189	5	470	8	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	3.91e-184	1	470	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999928	0.000117	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002329_00945.