CAZyme Information: MGYG000002329_02557

Basic Information

• Species: Dielma sp001305055
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Dielma; Dielma sp001305055
• CAZyme ID: MGYG000002329_02557
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230		26077.93	4.6678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002329	3357599	Isolate	not provided	not provided

• Gene Location: Start: 54528; End: 55220 Strand: -

Full Sequence      

MKKLIKAFALTIMACFMVLLVLGFIEYRSVIREMPIQDKVASIMQKDDYVPIDEISDYLK
VATISTEDKRFYKHQGVDLIAYGRILYVFITSGQISGGGSTITQQLAKNMYFSFQPSIIR
KVAEFFVTKDLERLYDKDTLLELYLNIINYGDNNIGIASASMNYFHVEPADLSFDQATLL
AGIPQSPANYQLSNHEDQARLRQQAVLATIEDNGYYDDDELARLLLGVNP

Enzyme Prediction     

No EC number prediction in MGYG000002329_02557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	43	209	4.2e-55	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	5.20e-66	45	209	11	175	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.77e-61	48	225	77	255	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.46e-59	49	215	4	170	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	9.39e-53	1	220	1	240	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK00056	mtgA	1.61e-38	1	211	4	220	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK21420.1	4.38e-71	1	224	4	227
QSI25809.1	5.15e-71	2	222	5	226
QIX09702.1	9.70e-71	2	225	5	228
ASU17506.1	9.70e-71	2	225	5	228
ANU70075.1	9.70e-71	2	225	5	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.98e-36	44	220	17	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	5.56e-36	44	220	17	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	8.88e-28	38	229	48	245	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.05e-27	38	229	12	209	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.07e-27	38	229	13	210	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	7.54e-36	38	220	57	240	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P39793	7.13e-34	45	220	93	269	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
A0A0H2ZMF9	1.57e-33	25	220	89	280	Penicillin-binding protein 2a OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=pbp2a PE=1 SV=1
Q8DNB6	1.57e-33	25	220	89	280	Penicillin-binding protein 2a OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbp2a PE=1 SV=1
O66874	2.54e-32	44	220	60	236	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.932023	0.015122	0.050362	0.000076	0.000046	0.002384

TMHMM  Annotations     

start	end
7	25