CAZyme Information: MGYG000002330_00539

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_00539
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40677.87	4.9121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 80927; End: 82009 Strand: +

Full Sequence      

MGKEVITKELEKRHIPELLRLSDNTPVDTPQLWETRRKEIRDILQKECYGYIPETGWETE
WETVSEEENAFGGKARMRTVDVRIRSGRGYVSYPFQLTVPKNIEKPPVFLYLSFFPLSSS
EIVEEITDNGFAVARVSYQDIAPDQNDGFQNGPGSLFPGNAYDSWGKLGVWAWGLSRIMD
YLVQEETIDAGRVAVVGHSRLGKAALLCGAMDERFSLVIACESGAGGAALFRGKEGENVA
DLCRNFPYWFCGNFKKWQNREEELPFDQHFTAALAAPRHLYLAGAVDDEWADPLSEFLTG
QAVTPVYEMLGQQGLAADRLPSTGDVFHEGRVGFHLRPGTHYMGRDDWKLFMEYRKKQGV

Enzyme Prediction     

No EC number prediction in MGYG000002330_00539.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	15	357	1.1e-81	0.9776951672862454

CDD Domains     

MGYG000002330_00539 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL53565.1	6.25e-133	6	360	4	360
QOV20253.1	5.89e-126	6	360	4	360
AEE95892.1	5.73e-91	5	360	1	362
QDU37053.1	9.39e-84	9	354	36	426
QNK58798.1	3.08e-81	15	357	8	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	2.93e-75	15	354	7	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	4.82e-75	15	354	25	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	7.43e-75	15	354	36	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	1.35e-74	15	354	25	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	3.79e-74	15	354	25	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	5.85e-61	9	354	36	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
D8QLP9	1.27e-27	15	311	36	324	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
B2ABS0	6.32e-27	33	311	141	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
P0CU53	1.21e-24	15	311	45	338	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
K5XDZ6	3.73e-23	15	311	44	336	4-O-methyl-glucuronoyl methylesterase OS=Phanerochaete carnosa (strain HHB-10118-sp) OX=650164 GN=PHACADRAFT_247750 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_00539.