CAZyme Information: MGYG000002330_00766

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_00766
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
696	MGYG000002330_23|CGC1	79633.32	5.6992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 36938; End: 39028 Strand: +

Full Sequence      

MKEWKAKWIMFETCPENVTPVFRRIFSLAKRPESASIDICGLGFYYLKINGKRVGEELLQ
PAFTAYDRTVLYNTCDITEFLTEGSNEIEVTLGNGWFHEPGEDCFDFEHAVWKNHLQLIC
QIYADGQFILWSDTKWQCREGKWSYNSVRFGENYDAGAEEKEWSQAVIAKGPGGILKEQK
LPGIRIQEYRQPVSVKNGVYDFGRNLSGDVEITLDGQKGDTVEILYGERLDGQGNIDQTL
IKRHCDIPRNQIDFYRKGSDEEESWHPEFSYKGFRYVQVKGEAAVRQIRARVFYTDFKTA
GGLQCSDPVLQSIYDASLWSVKTNFHHIPTDCPHREKNGWTGDAHMSCEFALLNLDMEDA
YLQYLDSLADCQWPSGQLPCIAPTSVYGYNYQSGPTWDGALIFIPWQLYRFTGKKEIPER
YYEAMKKYMRYTQQISEDGICKSGLGDFLPDESQEVCPAGMILSCFVMRMAQIMEQISAL
LQKGDEKEWKALADYVKAAILRDYYGSCNRTESYLSCVLFFGLSENPEKEAKELADIVRR
KGHRAGGGIFGSVYTLEMLTRYGYQEDALKIAGQKEFPGWAFMLQNGGGTLWEHWSGKKG
SLNHHMRSTVGAWMFKALTGLVPEECEPGWSRIVLRPCFSDRVKEFSAWHNTPMGRVKII
RNGGRMCVELPDGVSASVYWKGSLYEIAGRQELQLW

Enzyme Prediction     

No EC number prediction in MGYG000002330_00766.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	199	679	4.4e-120	0.9781746031746031
CBM67	6	166	1.2e-23	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.03e-78	298	618	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.33e-40	30	188	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.90e-19	199	294	9	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.53e-06	627	679	6	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM09766.1	1.75e-252	2	690	3	696
AHF16194.1	1.00e-139	3	660	136	837
QGQ94103.1	1.92e-138	2	686	121	850
AVM44977.1	2.44e-138	6	674	6	697
AVM44981.1	1.59e-135	2	678	27	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.84e-91	2	659	143	873	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.60e-75	22	655	134	810	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	6.62e-59	30	679	314	993	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.20e-84	22	658	187	880	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.37e-63	3	657	148	851	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	3.42e-58	30	679	314	993	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	9.23e-55	3	676	145	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	1.73e-09	196	624	603	1078	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_00766.